Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G102365-GRMZM2G102382
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191145
Function (paralog2):hypothetical protein LOC100193986

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.42365637487294
Log2 mRNA fold difference:-0.99657243069459
Log2 TE fold difference:0.61003437843807
Sequences
Protein sequence

MAAAQAISKGSVVSPCGNRAAPGFLARRRGAVAARMAPSAARIGGFWRKNAFPGGRLTLR
TRRSRAASPTQVNIQDMNMNLALGKSMRWWEKGLQPNMREIESAQDLVDALTNAGDRLVV
VDFFSPGCGGCRAFHPKICQFAEQNPDVLFLQVNYEEHKSMCHSLHVHVLPLFRFYRGAQ
GRLCSFSCTNATIKKFRDALAKHKPDRCSLGPTRGLEESELLALAANKDLQFTYAKQEPE
LIPRGDAPGEVVAPEPAKLPAAPKPLVRLGSEERSGWSRQEDEMHMRLS*

MAAAQVVAKGSVVSPCGNRAVPGLLGRRRDAVAAQMTPSAVRIGGSWRKNAFPGVRLALG
TRRSRPASRSFSASPVQMNMNLAIGKSMRWWEKGLQPNMREIESAQDLVDSLTNAGERLV
VVDFFSPGCGGCRALHPKICQFAERNPDVLFLQVNYEEHKSMCYSLRVHVLPFFRFYRGA
QGRLCSFSCTNATIKKFKDALAKHKPDRCTFGPTRGLDESELLALAANKELQFTYTREPE
LTPMGDTPGEVIAPEPAKLPAATKPLVKLGSEERSLVSPGR*

Other information
Ka divergence:-0.123121KaKs divergence:0.00929032
GC content 1 (%):57GC content 2 (%):59GC content divergence:0.017
Length 1 (bp):870Length 2 (bp):846Length divergence:-0.014
MFE 1 (kcal):-365.04MFE 2 (kcal):-349.94MFE divergence-0.021