Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G102447-GRMZM2G308689
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274600
Function (paralog2):hypothetical protein LOC100272811

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.1844113508282
Log2 mRNA fold difference:-0.35487825154947
Log2 TE fold difference:-0.8535130073413
Sequences
Protein sequence

MGKEGVAAGPAAEGSKSRSECINSSNPYHECSDYCLRKIAEARQRLDDELPDSWKRPPEQ
RTVHPDCINASNPYHECSDYCFKRIADAKSPACGAGDSFPVNSNRLEREERQPPADVFAA
AGMSDAVEQHRPIDNDSDEQEGAGPDDGYPQMTEKQKKLFELRLKMNEARKANQQAMVAE
KKRMEPRGESRGVSKQKWLDDRKKKIGKLLDSNGLDMKMAYMLDTQETAEAKYKKWEKEP
APYGWDVFNQKTLYDAYKKRTKNIEVDMESYNKAKEADPEFYRDASSLQYGKVSNVPEEN
IDKMVKELREREEKRKSFSRRRKFNEDKDIDSINDRNEHFNKKVERAFGKYTLEIKNNLE
RGTALPD*

MGKEGVVAGPAADGSKSRPECINSSNPYHECTDYCLRKIAEARQRLDDELPDSWKRPPEH
RTVHRDCINACNPYHECSDYCFKRIADAKSGLERGEQQPPADVATAAGTSDAVEQQQLED
NDADGQEGAAADDGYPQMTEKQKKLFELRLKMNEARKANQQAMVAEKKRMEPRGESRGVS
KQKWLDDRKKKIGKLLDSNGLDMSKAYMLDTQETAEAKYKKWEKEPAPYGWDVFNQKTLY
DAYKKRTKDIEVDMEAYNKAKEADPEFYRDASSLQYGKVSNVPEENIDKMVKELKEREEK
RKSFSRRRKFNEDKDIDSINDRNEHFNKKVERAFGKYTLEIKNNLERGTALPD*

Other information
Ka divergence:-0.236727KaKs divergence:-0.297861
GC content 1 (%):55GC content 2 (%):56GC content divergence:0.009
Length 1 (bp):1104Length 2 (bp):1062Length divergence:-0.019
MFE 1 (kcal):-405.5MFE 2 (kcal):-394.5MFE divergence-0.014