Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G102499-GRMZM2G078641
Species:maize
Duplication type:WGD
Function (paralog1):14-3-3-like protein GF14-6
Function (paralog2):14-3-3-like protein GF14-12

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MYICRSGVLQILKLNCKMASAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEEL
TVEERNLLSVAYKNVIGARRASWRIISSIEQKEEGRGNEDRVTLIKDYRGKIETELTKIC
DGILKLLETHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYKAAQD
IALAELAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLSEESYKDS
TLIMQLLRDNLTLWTSDISEDPAEEIREAPKRDSSEGQ*

MASAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEELTVEERNLLSVAYKNVIG
ARRASWRIISSIEQKEEGRGNEDRVTLIKDYRGKIETELTKICDGILKLLESHLVPSSTA
PESKVFYLKMKGDYYRYYDCMNPIVVIRYLAEFKTGAERKDAAENTMVAYKAAQDIALAE
LAPTHPIRLGLALNFSVFYYEILNSPDRACSLAKQAFDEAISELDTLSEESYKDSTLIMQ
LLRDNLTLWTSDISSCLYYSLRAERRRPHHHGSASAHPLPPRRDARQSRHRVLRAPPISQ
RRARQTLFPTAVPLSPPTGDHALPPSPQRPPDPAWHTPEIALFPTESGLAHTGDHALPPF
PTVATGSSMAHARSSMAHPQRERPEWSSEHPCTHWRPGHSPPQSPPHPIPPRITPNPHPD
PETFIHLPWSLSLFGSNIREFGSVSGSDGVTGVASNADAVAMWMVSCRAPCGWCSSPQAT
PRLRPRCPPQHPQHPGGWAARDTRSSQSPTSRWVATASAIGIHHKTTQWRARSSLLERMH
VLDEANYLVKRAASIQAAVPSVNSAPAVTSGGPFKLPNGVGKPAAPLADLLDLSSDDAPV
TISAPTTAPNDFLQDLLGIGLTHSSPIGGAPSISTDILMDLLSIGSSSVQNGPPTSNFSL
PSIETKSVAVTPQVVDLLDGLSSGTSLSVHPVRLDPASNSTLPASGNGSVTQSLSVTNNQ
HGQISKGFKFNVKGVVVVLDKFSGRSRGLGFVNFNEKQAMEDAIEATNGLCLDGSNITVD
KARPHGPSRDRNGDRYYDRELGSRYDHGRNYGGGCALRGGGGDCFKCGNPIILLETTHLG
TVGEGTNMVVGMTCMVVLEVVMVLIVAVTNTLVIVEMAVAIGAATVMALIDQVLPDGLSS
*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):54GC content divergence:0.019
Length 1 (bp):837Length 2 (bp):2703Length divergence:0.527
MFE 1 (kcal):-293.96MFE 2 (kcal):-971.52MFE divergence0.535