Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G102514-AC194970.5
Species:maize
Duplication type:WGD
Function (paralog1):BES1/BZR1 protein
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MTSGAAAAGGLGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLK
ALCREAGWVVEDDGTTYRKGCRPPPGMLSPCSSSQLLSAPSSSFPSPVPSYHASPASSSF
PSPTRLDHSSGGSSTHNPAAAAAAAAASLLPFLRGLPNLPPLRVSSSAPVTPPLSSPTAA
AASRPPTKVRRPNWDAAAAVVAADPFRHPLFAVSAPASPTRARRREHPDTIPECDESDVC
SAVDSARWISFQATTAPASPTYNLVHPASDSMELDGTTAAVEEFEFDKGRVVTPWEGERI
HEVAAEELELTLGVGAK*

MDPSDSNSAAGGKTQNVSVPPVEGVAGGGTSYGWVDGGLRGTNIGAGVIDPTKVHSDDLL
HVWSMPSTANVSQQEAPRPLEKVNLLAARNERESFQIALRPKVSWATSGIAGSVQIQCTD
LCSSSGDREDQHSHSSIPMVINVVPGVPDALVPIDPLSPQISIQPGETAAVWVSVNVPCG
QPPGLYEGEIFITAVKTELEILSNLVTLALISGLYFFADLISGSSSRTESLPKSEKCRLY
RELRSCLDLTGPRDYSSPEEMVQRLTSASTVLRRVLDNPALQDCQENNGFGDMMDEDVIN
NISVRLKLSLTVWDFTLPVTPSLPAVFGVSWQYSFLLCSISISVLCNCYGTGCNGLRLMG
LLGPAELAATEGSVGIAAALAKPAAGTPDHPKANEYYSDPRLAAYAVPYAPILSCLLLYL
IWLLVNSTDAAKNSLRREVEILKSKPHWSKAYFYLWDEPLNVEQYDMICNISNELRSYAP
DVRILTTYYCGATCADLEHPVGVPGCPLSSRAAGPSGSELAPSTFEAFAKVPNVLRPHTQ
IFCTSEWVLGTREDLVKDIVAELRPDLGEEWWTYVCMGPSDPQPNWHLGMRGTQHRAVMW
RVWKEGGTGFLYWGSNCYEKAMIPSAEICFRRGLPPGDGVLFYPGEVFSSSHEPVASTRL
ERILSGMQDIEYLKLYSSRYGREEGLALIEKTGMYLGPDRYTLDHGPVDVMRGEVYRTCR
S*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):74GC content 2 (%):46GC content divergence:-0.233
Length 1 (bp):954Length 2 (bp):2166Length divergence:0.388
MFE 1 (kcal):-514MFE 2 (kcal):-730.72MFE divergence0.174