Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G102550-AC194970.5
Species:maize
Duplication type:WGD
Function (paralog1):Putative geranylgeranyl pyrophosphate synthase 2
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPSCQQPNTTTPSTKHHHRPGGHSTSPLAVLHRRGQRQSFSSPQEFKTRQIATSRGHPQS
PTLPSPALYPQAQPNSPPMAMAFHFHPLVASRVHFSPLPFAAATGAPSPSSSVAIAAHYH
HHGRRRFSAIVATATTTEFNFKAYMEERAVAVNRALDAAIPAGGLPAALHDAMRYALLAG
GKRVRPALCLAACAVVGGPESWAMPAAAAVEMVHTMSLVHDDLPCMDDDDLRRGKPTCHV
VYGEPIAVLAGDALLSLSFHHMASVGSYPPAVDPEKHPARVVRAIGELARCIGSEGLVAG
QVVDLEMTGTSQTVPLELLEYIHLHKTAALLEASVVIGAIIGGGTDEQIEALRKYARSIG
LLFQVVDDILDVTKSSEELGKTAGKDLASDKTTYPKLLGLAKSREFAEKLVSDATEQLAC
FDEEKAAPLLHLANYIAHRQN*

MDPSDSNSAAGGKTQNVSVPPVEGVAGGGTSYGWVDGGLRGTNIGAGVIDPTKVHSDDLL
HVWSMPSTANVSQQEAPRPLEKVNLLAARNERESFQIALRPKVSWATSGIAGSVQIQCTD
LCSSSGDREDQHSHSSIPMVINVVPGVPDALVPIDPLSPQISIQPGETAAVWVSVNVPCG
QPPGLYEGEIFITAVKTELEILSNLVTLALISGLYFFADLISGSSSRTESLPKSEKCRLY
RELRSCLDLTGPRDYSSPEEMVQRLTSASTVLRRVLDNPALQDCQENNGFGDMMDEDVIN
NISVRLKLSLTVWDFTLPVTPSLPAVFGVSWQYSFLLCSISISVLCNCYGTGCNGLRLMG
LLGPAELAATEGSVGIAAALAKPAAGTPDHPKANEYYSDPRLAAYAVPYAPILSCLLLYL
IWLLVNSTDAAKNSLRREVEILKSKPHWSKAYFYLWDEPLNVEQYDMICNISNELRSYAP
DVRILTTYYCGATCADLEHPVGVPGCPLSSRAAGPSGSELAPSTFEAFAKVPNVLRPHTQ
IFCTSEWVLGTREDLVKDIVAELRPDLGEEWWTYVCMGPSDPQPNWHLGMRGTQHRAVMW
RVWKEGGTGFLYWGSNCYEKAMIPSAEICFRRGLPPGDGVLFYPGEVFSSSHEPVASTRL
ERILSGMQDIEYLKLYSSRYGREEGLALIEKTGMYLGPDRYTLDHGPVDVMRGEVYRTCR
S*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):66GC content 2 (%):46GC content divergence:-0.179
Length 1 (bp):1326Length 2 (bp):2166Length divergence:0.241
MFE 1 (kcal):-580.69MFE 2 (kcal):-730.72MFE divergence0.114