Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G102664-GRMZM2G333623
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.6660514394999
Log2 mRNA fold difference:1.2490264338822
Log2 TE fold difference:0.42772256411524
Sequences
Protein sequence

MSKAPDDHLQATEQEGSVHPSQQAGQQHVNAAYQFSKTELTEGSKNEQPVQVEQLSSHLQ
QAYPEIQLQQAETDSFQLAEKETGYFGQQSFAGAKVDVAQPSVVQQNVKQTVGQQASSGT
QDTRKGPSIPFNMLIPILQAHLDRDKDMQLQTVWAKLRRNEVNKDDFLRVTVNIVGDQML
KQAAHKVFVQMQAQMQRNSQANSSQQSLFSQLSAQQMASSGSAQLHDQKIRPPGPPNQGQ
KNQVSSSPQAFAPPSGTQPQNSVHYLAHDNPNQNPDAKGTNVVPNQPSRMNTSVPLQTKD
KQHQPTQLQQASQQIYGANNPGAQAYPRSITGSLRSPSPVPETQPSMHAPGMAPAKMVPP
PTHPMMQHNATAWKMHQNRELKTNAPPPNANMKQNSESVGKVRMAGTGNSSAKGKQGTPN
STPNASGGTKSSKKSGGQKKSLEAAGSMQPSSKKQKKSGAPQEQSIDELNDVTAASGVNI
REEEEQLLSAPKEESFASQEARRIAQEEENIFLRKGPLLRKLAEIG*

MSKAPDDHLQATEQEGSVHSSQQAGQQHVNTADQFSKTELTEGSKIEQPVQVEQQSSHLQ
QAYPEIQLQQAETDSFQLAEKETGYFGQQSSAGAKVDVAQPSVVQQNAKQTVGQQASSGT
QDTKKGPSIPFNMLIPILQAHLDRDKDMQLQTVWAKLRRNEVNKDDFLRVIRNIVGDQML
KQAAHKVFVQMQAQAQRNSQANSSQQSLFSQLSAQQMASSGSAQLHDQKIRPPGPPNQGQ
KNQVSSSPQAFAPPSGTQPQNSVHYLAHDNPNQNPDAKGTNVVPNQPSRMNTSVPLQTKN
KQHQPTQLQQASQQIYGASNPGAQAYPRSITGSLRSPSLVPETQPSMHAPGMAPAKMVPP
PTHPMMQHNATAWQMHQNRELKTNAPPPNANMKQNSESVGKVRMAGTGNSSAKGKQGTPN
STPNASGGTKSSKKSGGQKKSLEAAGSMQPSSKKQKTSGGSQEQSIDELNDVTAASGVNI
RADGSGATELEKEKEESRPKNVKPNKEEDDKMRANAANVAARQAVGGSDMLSKWQLMAEQ
ARQKREGIDVSAASQPGRGPGSRQLSKFGKGPGEHPEGSKRSHSMAFGTGGMKRPGRTAF
AGPQRLISVKDVICALEREPQMTKSRLIYRLHERLPVDSTVD*

Other information
Ka divergence:-0.783565KaKs divergence:-0.447672
GC content 1 (%):44GC content 2 (%):45GC content divergence:0.011
Length 1 (bp):1581Length 2 (bp):1929Length divergence:0.099
MFE 1 (kcal):-423.64MFE 2 (kcal):-567.3MFE divergence0.145