Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G102795-GRMZM2G007021
Species:maize
Duplication type:WGD
Function (paralog1):SEC13-related protein
Function (paralog2):SEC13-related protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MPPHKIETGHQDVVHDIAMDYYGKRLATASSDNTIKIIGVSGTSHQQLATLSGHQGPVWQ
VAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALAHTFAEHKSSVNSIAWAPHELGLCL
ACGSSDGNISVFAARSDGGWDTTRIDQAHPVGVTSVSWAPAMAPGALISAGSSGQFEYVQ
KLASGGCDNTVKVWKLNNGSWRMDCFPALQMHKDWVRDVAWAPNLGLPKSTIASASQDGT
VVIWTAAKEGEQWDGRVLYDFRTPVWRLSWSLTGNILAVSDGNNNVTLWKEAVDGEWQQV
TTVEP*

MPPHKIETGHQDVVHDVAMDYYGKRLATSSSDNTIKIIGVSGTSHQQLATLSGHQGPVWQ
VAWAHPKFGSMLASCSYDGRVIIWKEGSKPDEWALVHTFAEHKSSVNSIAWAPHELGLCL
ACGSSDGNISVFTARSDGGWDTTRIDQAHPVGVTSVSWAPAMAPGALISAGSSGQFEYVQ
KLASGGCDNTVKVWKLNNGSWRMDCFPALQMHKDWVRDVAWAPNLGLPKSTIASASQDGT
VVIWTAAKEGEQWEGRLLYDFRTPVWRLSWSLTGNILAVSDGNNNVTLWKEAVDGEWQQV
TTVEP*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):918Length 2 (bp):918Length divergence:0
MFE 1 (kcal):-343.52MFE 2 (kcal):-337.61MFE divergence-0.009