Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G102959-GRMZM2G079381
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384717 (LOC100384717), mRNA
Function (paralog2):Ferredoxin--nitrite reductase, chloroplastic Precursor; Fragment (EC 1.7.7.1)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASTASLQRFLPASPHASSRRRAGRARAAVSIPSSSPPATRDNEVPAERLEPRVEAREGG
YWSLKERYRTGLNPHEKVKLEKEPMALFMDGGVRDLAKIPMEVIDAAKLTKDDVDVRLKW
LGLFHRRKHQYGRFMMRLKLPNGVTTSEQTRYLASVIEAYGADGCADVTTRQNWQIRGVT
LPDVPAILDGLRAVGLTSLQSGMDNVRNPVGNPLAGVDPHEIVDTRPYTNLLSSYITSNS
QGNPAITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGKFGFNLLVGGFISPKRWAE
ALPLDAWVAGDDVVPACKAILEAYRDLGFRGNRQKTRMMWLIDELGMEVFRSEVEKRMPN
GVLERAAAEDLVDKKWERRDYLGVHPQKQEGLSYVGLHVPVGRLQAADMFELARLADEYG
TGELRLTVEQNVVLPNVSNRRLDALLAEPLLQRQRLSPQPSLLLRGLVACTGNQFCGQAI
IETKARALQVAREVEKRVAVPRPVRMHWTGCPNSCAQVQVADIGFMGCLTKDRDGKVVEA
ADIFVGGRVGSDSHLADVYRKSVPCKDLVPIVADLLVERFGAVPREREEEDEE*

MASSASLQRFLLPSSHAAATAASPSSRLRRTGRARAAVSVPPPAAAGEQVPTERLEPRVE
ERAGGYWVLKEKYRAGLNPQEKVKLEKEPMALFMEGGIQDLARVPMEQIDAAKLTKDDVD
VRLKWLGLFHRRKHQYGRFMMRLKLPNGVTTSEQTRYLASVIEAYGADGCADVTTRQNWQ
IRGVTLPDVPAILDGLRAVGLTSLQSGMDNVRNPVGNPLAGVDPHEIVDTRPYTNLLSSY
VTNNSQGNPTITNLPRKWNVCVIGSHDLYEHPHINDLAYMPAVKDGEFGFNLLVGGFISP
KRWAEALPLDAWVAGDDVVPVCKAILEAYRDLGSRGNRQKTRMMWLIDELGMEVFRSEVE
KRMPNGVLERAAPEDLVDKRWERRDYLGVHPQKQEGLSYVGLHVPVGRLQAADMFELARL
ADEYGTGELRLTVEQNIVLPNVSNERLDALLAEPLLQEQRLSPRPSMLLRGLVACTGNQF
CGQAIIETKARALQVAREVEKRVAVPRPVRMHWTGCPNSCGQVQVADIGFMGCLTKDSDG
KIVEAADIFVGGRVGSDSHLADVYRKSVPCKDLVPIVADLLVERFGAVPREREEDEE*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):69GC content 2 (%):70GC content divergence:0.007
Length 1 (bp):1782Length 2 (bp):1794Length divergence:0.003
MFE 1 (kcal):-895.48MFE 2 (kcal):-941.71MFE divergence0.025