Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G103258-GRMZM2G041885
Species:maize
Duplication type:WGD
Function (paralog1):signal peptide peptidase-like 3
Function (paralog2):LOC100282700

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MESLWKLTYLLDPASVALIATAISVAYASASRALDYGKEMERNLDFSEASITLDRSQALM
IPLASSCSLLLMFYLFSSVSHLVTAFTAVASALALFFCLSPHITYLKARFNLMDPFMSRC
CSKSFTRLQGLLMLFCIATVLAWLVSGHWMLNNLLGISICIAFVSHVRLPNIKICALLLA
CLFVYDIFWVFFSERFFGANVMVSVATQKASNPVHTVANKLSLPGLQLITKKLELPVKLV
FPRNLLGGIVPGSNPGDYMMLGLGDMAIPGMLLALVLFFDNRKLKDVNVVPSDVSPLRRR
NYVWYALTGYGIGLVAALAAGILSQSPQPALLYLVPSTLGPVMYLSWFRNELWELWEGSG
TILNDKARLLEV*

MESLWKLTYLLEPASLALIATAISVAYASASRALDYGKEMERNLDFSEASITLDRSQALM
IPLASSCSLLLMFYLFSSVSHLVTAFTAVASAMALFFCLSPYVTYLKMQFNLMDPFVSRC
CSKSFTRLQGLLMLFCIATVLAWLVSGHWLLNNLLGISICIAFVSHVRLPNIKICALLLA
CLFVYDIFWVFFSERFFGANVMVSVATQKASNPVHTVANKLSLPGLQLITKKLELPVKLV
FPRNLLGGIVPGSNPGDYMMLGLGDMAIPGMLLALVLFFDNRKFKDVNFPPDVSPPKRRN
YVWYAVTGYGIGLVAALAAGILSQSPQPALLYLVPSTLGPVMYLSWLRNELWELWEGSGT
ILNEKAHLLEV*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1119Length 2 (bp):1116Length divergence:-0.001
MFE 1 (kcal):-383.03MFE 2 (kcal):-361.86MFE divergence-0.028