Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G103544-GRMZM2G118409
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381712
Function (paralog2):MAC/Perforin domain containing protein (LOC100283592), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.9021844238745
Log2 mRNA fold difference:-2.3968521582874
Log2 TE fold difference:0.4755623999352
Sequences
Protein sequence

MSLTGSALEAALQAVGRGLDAAGDHRLLYCKGGGRLVALEEDRARDLPLPDGGVLPSVPP
DVEVEQCRRDPERIRPFPSGPSSAAADGPFVCSFDKMAEYFNRKSCLSETVPLGSFNSLF
SFTGSWKNDAAATKALAIDGYSLPLFRVKIRSSELTLLESVKHAIPNVWDPSALASFIEN
YGTHIIISVTVGGKDEVYIKQHSSSQLSGLEFKNYVREIGRERFSDVENKSNATPINYSE
KDITVIFRRRGGCDLVQSFSDWKGTVASAPDVIGMTFLSIVSLVDDVPGKKHLARAVELY
LTYKPPIEELQYFLDFQVPLVWAPAPPGIASHHRKEPVCPSLQFSLMGPKLFISTEQISV
GRRPVVGLKLLLEGAKQNRLAIHLQHLVSLPKIFLPHWDSHITIGPPKWQGPEEQDSRWF
EPIKWKNFAHVSTAPIEYTETNITDLSGVYIVTGAQLGVWDFGAKSVLHLKLLFSRVPGC
TIRRSVWDHSPSSSSIHKADESSSSSSDNAKLLKIIDMTETLKGPQDAPGHWLITGAKLG
VEKGRIVVRAKYSLLNY*

MSLAGSALEAALLAVGRGLDAAGDHRLLYCKGDGRLVALEDRARDLPLPDGGVLPSVPHD
VEVEQCRRDLERIRPFPSGSGPSSAAADGPFVCSFDKMAEYFNRKSCLSETVPLGSFNSL
FSFTGSWKNDAATTKALAIDGYSLPLFRVKIRNSELTLLESVKRRIPNVWDPSALASFIE
NYGTHIIISVTVGGKDEVYIKQHSLSQLSELEFKNYAREIGRERFADVENKSNASSINYS
EKDMTVIFRRRGGCDLVQSFSDWRGTVASAPDVIGITFLSIVSLVDDIPGKKHLARAVEL
YLTYKPPIEELQYFLDFRVPLVWAPAPPGIAGHHRKEPVCPSLQFSLMGPKLFISTEQIS
VGRRPVVGLKLILEGAKQNRLAIHLQHLGSLPKIFLPHWDSYITIGPPKWQGPEEQDSRW
FEPIKWKNFAHVSTAPIEYTETNITDLSGVYIVTGAQLGVWDFGAKSVLHLKLLFSRVPG
CTIRRSVWDHSPSSSSVHRTDESSSSSSDNAKLLKIVDLTETFKGPQDAPGHWLITGAKL
GVEKGRIVVRAKYSLLNY*

Other information
Ka divergence:0.38085KaKs divergence:0.420762
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):1674Length 2 (bp):1677Length divergence:0.001
MFE 1 (kcal):-560MFE 2 (kcal):-570.66MFE divergence0.009