Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G103713-GRMZM2G159828
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277694
Function (paralog2):hypothetical protein LOC100194067

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7513750906525
Log2 mRNA fold difference:-1.4394711738531
Log2 TE fold difference:-0.26883487674131
Sequences
Protein sequence

MKASIKFRDDDRPLLRAKVPVGVLGLPFFSGLVAGGDAKDLRFDLSTAFTSGPALRLSYR
PNEPLQPFALSIRTGLGPLGSPVRAPFALAAEFNLTSSNPPAFSLVFKPRIGDFAVASSV
RSPPPPPPASTLPPLSVKMSDLVTNGDDHDRKAHGNGFSFSGNGFAANVAAAAGTGGGGV
GALLSRMRLTTRSVLPLWSKASLRFQWGLRVPPEIKAALADDGYGRKAGSLAISKLPLLV
MNKITIEHTPKVPSQSETDKKRKKDAPPAAEGEVFSLMKRQLEELNAESTMLRLAVEDLR
AEVGASKGDGRKLPATVPHPQRSFVSKPDHHFHSDAKDLGDSGTKPASNDASEGLKKALE
ARRK*

MKASIKFRDDDRPLLRAKVPIGVLGLPFLSGLAAGGDAKDLRFDLSTAFSSGPALRLSYR
PNEPLQPFALSVRTGLGPLGSPARAPFALAAEFNLTSSNPPAFSLLFKPRIGDFAVASSV
RSPPTPPPTSTPPPLAIKMVDLTTNGDDHDCEAHGNGFSFNGNVLGANVAAVTGTDGGGG
GVGALLSGMRLTTRSMLPLWSKASLRFQWGLRVPPEIKATLADNGYGRKAGSLAISKLPL
LVMNKITIEHTPKVPSQSETDKKRKKDTPPAAKDEELSFMKRQLDKLNVENTMLRRAVED
LRAEIGAGKGDDRKLPTAVPPQQHSLVSKPDRHFHINAKELVDSGTKPASNEASEELKKV
LEGRRK*

Other information
Ka divergence:0.0674876KaKs divergence:0.206457
GC content 1 (%):65GC content 2 (%):62GC content divergence:-0.024
Length 1 (bp):1095Length 2 (bp):1101Length divergence:0.003
MFE 1 (kcal):-474.44MFE 2 (kcal):-448.07MFE divergence-0.029