Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G103884-GRMZM2G106338
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100192847 (LOC100192847), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.6102711005243
Log2 mRNA fold difference:-2.8101401026344
Log2 TE fold difference:0.19753366585974
Sequences
Protein sequence

MPDSADPLPTQPSPDPDMPPRKPLAGGKLKKPLTDKQRAAAEQRLSHLRAHLILRSLDSP
AGGARALPPPQEAALDALGLLNFFRLDLQSDTPRPDLIAPLVAYYDPVCKRSFVRGVRVS
VSRHHITRALCLPSKPASAAPAPADVDPAAVVPAVMQLLQDYVLLPFQGGDMCILPQEVA
AAEQMVREGAAHRVDWGGLIWGLVEKEMLELPKREDGVCYYGPHLQRLIYSEKPHLLELV
EEGPVPEASADVEMEDEDGDVDLKSKNLVELEPGDGDGEAGNDVRSESLKDSELGNAGAR
NDGLDKLELGDAVTRNKVMEELGLRDVDARNNSIEELEVVEEDARSKSLNECEAVDVDLD
AMDININDRETINGDTRSKSLNESEAVDLDPDAMENNIDEMETVNEDARTKSLDEFEAVD
VAPDAMDNNIDEMGVVNEDARSKGLNESEAVDAINNNIVELDAVNEDARCKSLNDESELV
EEEFKSPSFDDMNTVDEHVNGTDTDGLCLGFVEVEAVPAVHEAMPDNNEETTEEAPAGGA
DVAGSDNVAVPTDVDCEEHYVEAVVVTQEVVAVAEELGDEEAKRDEEKDVMGLSLGFNST
NGYGAMDVEKETNVESLDEDESDSGNEEAEESEDGAFDVNDGEDMNWRIGDVNGGEGMTH
SLQRCNTFGGMEFENLNKGEDEMRDELRFDDFPARASLERMTSSNLLQAMNSIPSSYNVS
ENVHDLPSGDFLAMGADAHKSGVDLGPGSSYLFGNNGKRNIDDIDGYNGNMQVQEGFPRS
NQQKRMRHSNSSNISPGSGFFNASFSVPIQNLMVEASRLYEQNEQKLQSLQFEKQHWSDM
LQQKEAIIQSLNSARFEQHNKYQAELRRFEHDLNVMAQLVTTYKKALKQTRASFDEYRKK
FPCNVPLYGDVACGGGLVLSVRELEKRRCEEQQQNIAMVNGMIERFQYKWLSKFEEWGLS
VNSLWSRMEGLYKEIELLKENRRARFATPATEESTLATEGSTPATEE*

MPSWKPLAGGKLKKPLTDKQRAAAEQRLSHLRAHLILRSLDSPAGGARSLPPPQEAALDA
LGLLIFFRLDLQSGAPRPDLIAPLVAYYDRVCKRSFVRGVRVGVSRHHIIRALCLPSKPA
SAAPAPADVDPAAVVAAVMQLLQDYVLLPFQGDDRCILPQQVAAAEQMVREGAAHRVDWG
ELIWGLVEKEMLELPKREDWVCYYGPHLQRLIYAQKPHLLELVEEGPVQEPSANVDLKRK
SMVELEQGDGDREAGNNVKSKSLNDSESGKAGARNDGLDELELADAVTRNKVMGEFGLGD
VDARKNSIVKLEVVDEDARCKCLNEIQAVDAINNNIVELDAANEDARCKSLNDESEPVEE
DVKGPSFDDMNTVDEHVDGTNTDGSCLGFVAVEAVPAVNVEPDVVPDYPVIPTASPTNIK
RLKTFHKPSTNTKSNIGQNFSRLLEEHPKIAYDICNGPINMYKCTKKLLECGFTGKVLHI
AIKILKEDWEARQIFMALDRSESVTFISNAVGDYS*

Other information
Ka divergence:0.769158KaKs divergence:-0.631375
GC content 1 (%):51GC content 2 (%):53GC content divergence:0.019
Length 1 (bp):3024Length 2 (bp):1548Length divergence:-0.323
MFE 1 (kcal):-1038.47MFE 2 (kcal):-560.06MFE divergence-0.299