Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G103945-GRMZM2G108273
Species:maize
Duplication type:WGD
Function (paralog1):Aquaporin TIP4-1 (Tonoplast intrinsic protein 4-1)(ZmTIP4-1)(ZmTIP4;1)
Function (paralog2):Aquaporin TIP4-2 (Tonoplast intrinsic protein 4-2)(ZmTIP4-2)(ZmTIP4;2)

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.86846618945372
Log2 mRNA fold difference:-0.065349098356244
Log2 TE fold difference:-0.82064097007666
Sequences
Protein sequence

MRPPRLYQTVSSPLDRPPICYLSLWALARKRQVLFPLYETYVALHARRIRREARRRYADG
DAGGGGNRARAGRWRPGDGRVPRLRRPPEPRGDGGAHGARPHHQAPGGAVRRRPAAGLLR
RLRPPPLPQRRHGDPGARPGQGHQPDAGPGDGGHPHLLPALRHLRHDPGPAEPGPRHRPA
ADGPHRRRQQPRRRQLHRRVHEPGTLLRPGPGHRGLDKPLGLLDRPAARRAPGRLRVRVA
VPGAEDARAAAQWGSLTTISPCVVAHASCLFL*

MSHSPLPPPVFQNISLRFSESFSLQGTETTGAFTPPAFPSPPGTTGLLAIIRPSMAKLVN
KLVDSFDHHEAPAPDVGCVRAVLAELVLTFLFVFTGVSASMAAGAGGKPGEAMPMATLAA
VAIAHALAAGVLVTAGFHVSGGHLNPAVTVGILVRGHITKLRALLYVAAQLLASSLACIL
LRYLSGGMVTPVHALGAGISPMQGLVMEVILTFSLLFVTYAMILDPRSQVRTIGPLLTGL
IVGANSLAGGNFTGASMNPARSFGPAMATGVWTNHWVYWIGPLLGGSLAGFVYESLFMVY
KTHEPLLNGDI*

Other information
Ka divergence:-0.959391KaKs divergence:-0.169329
GC content 1 (%):66GC content 2 (%):67GC content divergence:0.008
Length 1 (bp):819Length 2 (bp):936Length divergence:0.067
MFE 1 (kcal):-385.9MFE 2 (kcal):-422.81MFE divergence0.046