Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G104012-GRMZM2G035779
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Ser/Thr protein phosphatase family

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MTPHLPAVSSSSTTTTSRAAAAAHHLLDAAAAPPSSPHQYRRRRRRRVLGCLRPRAASVR
CCAAAARAAEATTRVFVVSDLHTDYPENMEWVRRLPAQVGAGEGRGVDALVVAGDVAETR
DNFARTMEVLRERFAAVFYVPGNHDLWLRREGGLYMDSLEKLTALLDACSELGVDTGPRT
IGDLGIIPLFSWYHKSFDKEKDVNSVRVPSLEMACKDFHACQWPSDLTNDDEALALYFDK
LNDKNHDAIEEVKSSSKHILTFSHFVPRQELCPEKRMLYYPYLPKVIGSDFLERRLRDIH
SNREDRAACHVFGHTHFCWDSVVDEIRYVQAPLAYPRERKRRMNGEGWLPFCVYRDGFNP
EIYPALWSDYYNKNKREPENTQLAPWVASHYAKYHKFH*

MTPHLPAVSSSSTTTTSRAAAAAAAPPSSPHQYRRRRRRRVPGCLRPRAASVRCCAAAAP
APQAAVPAAARAEATTRVFVVSDLHTDYPENMEWVRRLPAEVGAGKGEGVDALVVAGDVA
ETRDNFARTMEMLRDGFAAVFYVPGNHDLWLRREGGRYMDSLEKLTALLDACSELGVDTG
PRTIGDLGIIPLFSWYHKSFDKEKDVSSVRVPSLEMACKDFHACQWPSDLTNDDEALALY
FDKLNDKNHDATEEVKSSSKQILTFSHFVPRQELCPEKRMLYYPYLPKVIGSDFLERRLR
DIHSNRKDGGACHVFGHTHFCWDSVVDEIRYVQAPLAYPRERKRRMNGEGWLPFCVYRDG
FNPEIYPALWSDYYNKNKREPENTQLAPWVASHFARYHKFH*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):57GC content 2 (%):57GC content divergence:0
Length 1 (bp):1197Length 2 (bp):1206Length divergence:0.004
MFE 1 (kcal):-469.4MFE 2 (kcal):-487.62MFE divergence0.019