Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G104430-GRMZM2G149979
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100384688

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.7731751623775
Log2 mRNA fold difference:-1.3691460934342
Log2 TE fold difference:-0.36259646012418
Sequences
Protein sequence

MAGDPPTAAEKETLVSSFLEIAAGQTPETATQFLLMTSWHLEEALQLFYIDGESALTPAH
PVAPPPTSAAASALAAAAGAEEAMRFAPPPAAALGDAMLHGFGVGEDDDVRAPLPVKRET
LYGEGIVSVMRPNASAAFRNFEQEARQSAVWDSDQNATSSSGDNLASLYRPPFSLMFNGP
FDKAKLEASSLDKWLLINLQSTAEFSSHMLNRDTWGNDAVAQLIRSNFIFWQVYYDTSEG
RKVCTYYHLVSMPAILLIDPVTGQKMHAWNGMVHPDRLLEDLLPYLDKGPKEHHAAQPQK
RPRKVDPEASTGKQGKIAVEDEDEELARAVAASLEESKEVIEASDASDDMVEAEPEEENE
PTLNTKPDYPPLPEEPTGSRDLLCRVAIRLPNNRRIQRNFLHTDPIKLLWSFCAPQVEDG
ERRAFHFVQAIPGASQKLELGSDLTFKEAGLANSMINLLLD*

MAGDPPTAAEKETLVSSFIEITAGQTLETATQFLQMTSWHLEEALQLFYIDGEAAHTAAH
SVDPSPAAAAPSALAAAAGVEEAMRFAPPPAAALGDAMSHGFGVREDDDVRAPLPVKRET
LYGEGIVSVMRPNASAAFRNFEQEARQSAVWDSEQNVASSSGDNLASLYRPPFPLMFNGS
FDKAKLEASSLDKWLLINLQSTEEFSSHMLNRDTWGNEAVAQLIRSNFIFWQVYYDTSEG
RKVCTYYHLVSMPAILLIDPVTGQKVHAWNGMVHPDRLLEDLLPYLDKGPKGHHAAQPQK
RPRKVDQEASTGKQGKIAVEDEDEELARAIAASLEVVIEASDASDDDMAEAEPEEENEPS
LNIKPDYPPLPEEPKGSRELLCRVAIRLPNNQRIQRNFLHTDPIKLLWSFCAPQVEDGEK
RAFHFVQAIPGASQKLQFGSDLTFRKAGLANSMINLLWG*

Other information
Ka divergence:0.259788KaKs divergence:0.195682
GC content 1 (%):54GC content 2 (%):53GC content divergence:-0.009
Length 1 (bp):1386Length 2 (bp):1380Length divergence:-0.002
MFE 1 (kcal):-527.9MFE 2 (kcal):-538.43MFE divergence0.01