Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G104760-GRMZM2G133566
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272420
Function (paralog2):hypothetical protein LOC100216997

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.9442491477045
Log2 mRNA fold difference:-0.56836939159729
Log2 TE fold difference:-2.3743917542361
Sequences
Protein sequence

MHPKLPRAARRLLCCGGAAASPEEDLSDEGRRSLRWVFSLRELRSATNSFNYDNKIGEGP
LGSVYWGQVWDGSQIAVKRLNNAKNGTEAEFASEVEILGRIRHKNLLSFRGYCADGPERV
LVYDFMANSSLYAHLHGPHSAECLLDWRRRASIAMGTARALLYLHRHATPKIIHGSVKAT
NVLLDSDFRAHAGDFGLARLIPDDGTDHEKIASSESQRGYLAPEYAAMSGKPTAGCDVYS
FGIILLELASGRRPVEKSGSGKACGIRSWVLPLARQGRYDEIADSKLGDKFSGPELRRMV
LVGLACTRSEPEKRPTMLQVVPLLKGESKETLVKLEREELFSPDSTTVSSQGTPTPDGST
DSAPPLKKDKELVGA*

MANSSLYAHLHGPHSAECLLDWRRRISIAINTARALLYLHHYATPKIIHGSIKTTNVLLD
SDFQAHVGDFGLIRFIPDGMDHEKITSESQRGYLAPEYIMFGKPTAGCDVYSFGIILLEL
ASGKRPIEKSCSVKTYGIRNWVLPLARQGRYDEIADSKLSDKFSESELRRMVLVGLACTH
SESEKRPTMLEVVPLLKGESKETLIKLERDELFSSDSMVSSQGTPTPDGGTDSVPKEDQE
LVGA*

Other information
Ka divergence:-0.21076KaKs divergence:0.468705
GC content 1 (%):57GC content 2 (%):44GC content divergence:-0.129
Length 1 (bp):1128Length 2 (bp):735Length divergence:-0.211
MFE 1 (kcal):-451.54MFE 2 (kcal):-227.34MFE divergence-0.33