Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G104836-GRMZM2G104876
Species:maize
Duplication type:TD
Function (paralog1):hypothetical protein LOC100273398
Function (paralog2):glycine-rich protein A3

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:3.6671446981427
Log2 mRNA fold difference:4.048237366735
Log2 TE fold difference:-0.52853600478424
Sequences
Protein sequence

MGGGKDKHDESDKGLFSNLMHGVAGGHGYPPQGYPPQGYPPQPGAYPPPPGAYPPPPGAY
PPQYGYPQPGGYPTQGGYPPAGYPGSSHQGYGSSHAGGHMGTGAMLAGGAAAAAAAYGAH
KLSHGHSGHGGHGPFGGHGRGRGRGGYGRGRGHHGKFKHGKHGHGMFSGKFKKWK*

MGGGKDKHDESDKGLFSNMMHGVAGGHGYPHQGYPPQGYPPQPGAYPPPPGAYPPPPGAY
PPPPGAYPPQYGYPQPGGYPPQGGYPPAGYPGSSHQGYGSSHGGGHGGHMGTGAMLAGGA
AAAAAAYGAHKLSHGHSGHGGHGAFGGYGHGGYGHGYGGHGKFKHGHGHHGKFKHGHGKF
KHGKHGHGMFGGGKFKKWK*

Other information
Ka divergence:-1KaKs divergence:-0.999462
GC content 1 (%):62GC content 2 (%):63GC content divergence:0.008
Length 1 (bp):528Length 2 (bp):600Length divergence:0.064
MFE 1 (kcal):-239.7MFE 2 (kcal):-256.8MFE divergence0.034