Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G104920-GRMZM2G126795
Species:maize
Duplication type:WGD
Function (paralog1):ubiquitin ligase protein COP1
Function (paralog2):hypothetical protein LOC100279342

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.13059761031372
Log2 mRNA fold difference:0.15304971899381
Log2 TE fold difference:-0.28659791164118
Sequences
Protein sequence

MGDSSVAGALVPSVPKPEPAPSGDTSAAAAATTAALAMPEEAGMRAASASPQGPAEEGEG
PADRDLLCPICMAVIKDAFLTACGHSFCYMCIVTHLSNKSDCPCCGHYLTKAQLYPNFLL
DKVLKKISAQQIAKTASPIDQFRCALQQGNEMGVKELDSLMTLIAEKKRQMEQQESETNM
QILLVFLHCLRKQKLEELNEIQTDLQYIKEDISSVERHRAELYRTKERYSMKLRMLLDEP
TAQKMWPSPIDKASCRFLPNSRTPLSGSCPGTLQNKKLDLKAQVSHQGFQRRDALTSSDP
PNSPIQSGNVIARKRRVQAQFNELQEYYLQRRRTGAQARRQEERDIVAMNREGYHAGLQD
FQSVLTTFTRYSRLRVIAELRHGDLFHSANIVSSIEFDRDDELFATAGVSKRIKVFEFST
VVNEPSDVHCPVVEMATRSKLSCLSWNKYSKNIIASSDYEGIVTVWDVQTRQSVMEYEEH
EKRAWSVDFSRTDSSMLVSGSDDCKVKVWCTNQEASVINIDMKANICSVKYNPGSSFYVA
VGSADHHIHYFDLRNPSSPVHIFGGHKKAVSYVKFLSNNELASASTDSTLRLWDVKDNCP
VRTFRGHKNEKNFVGLSVNNEYIACGSETNEVFVYHKAISKPAASHRFVSSDLDDADDDP
GSYFISAVCWKSDSPTMLTANSQGTIKVLVLAP*

MGDSSVAGALVPSVPKPETAPSGDNSTAALALPEEAGTRAASASPQGPAEEEGPADRDLL
CPICMAVIKDAFLTACGHSFCYMCVVTHLSNKSDCPCCGHYLTKAQLYPNFLLDKVLKKI
SARQIAKTASPVDQFRCALQQGNEMGVKELDSLMTLIAEKKRQMEQQESETNMQILLVFL
HCLRKQKLEELNEIQSDLQYIKEDISAVERHRVELYRTKERYSMKLRMLLDEPTAQKMWP
SPMDKASCRFPPNSRTPLGGSCPGTLQNKKLDPKAQRRVQAQFNELQEYYLQRRRTGAQA
RRQEERETVAMNREGYHAGLQDFQSVLTTFTRYSRLRVIAELRHGDLFHSANIVSSIEFD
RDDELFATAGVSKRIKVFEFSTVVNEPSDVHCPVVEMATRSKLSCLSWNKYSKNIIASSD
YEGIVTVWDVQTRQSVMEYEEHEKRAWSVDFSRTEPSMLVSGSDDCKVKVWCTKQEASVI
NIDMKANICSVKYNPGSSFYVAVGSADHHIHYFDLRNPSAPVHVFGGHKKAVSYVKFLSN
NELASASTDSTLRLWDVKDNLPVRTFRGHKNEKNFVGLSVNNEYIACGSETNEVFVYHKA
ISKPAASHRFVSSNLDDADDDPGSYFISAVCWKSDSPTMLAANSQGTIKVHVLAP*

Other information
Ka divergence:0.210042KaKs divergence:0.133527
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):2082Length 2 (bp):1968Length divergence:-0.028
MFE 1 (kcal):-662.75MFE 2 (kcal):-619.65MFE divergence-0.034