Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G105019-GRMZM2G149704
Species:maize
Duplication type:WGD
Function (paralog1):LOC100282745
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.9629279625301
Log2 mRNA fold difference:-3.613205245848
Log2 TE fold difference:0.70936195789529
Sequences
Protein sequence

MAASDLESKAKEAFVDDDFELATELYSQAIDAGPATADLYADRAQAHIKLGNYTEAVADA
NKAIELDPMMHKAYYRKGAACIKLEEYQTAKAALELGSSYASGDSRFARLLKECDERIAE
ESSQAPVKNVEATVAATIEDKEDFTNMENTPPVIEPPSKPKYRHDYYNSATEVVLTIFAK
GVPADSVVIDFGEQMLSVSIEVPGEEPYHFQPRLFSKIIPEKCKYQVLSTKVEIRLAKAE
QVTWTTLDYSGRPKTVPQKISTPAETAPRPSYPSSKAKKDWDKLEAEVKKEEKEEKLDGD
AALNKFFRDIYKDADEDMRRAMMKSFVESNGTVLSTNWKDVGAKKVEGSPPDGMELKKWE
Y*

MAASDLESKAKEAFVDDDFELAAELYTQAIDAGPATADLYADRAQAHIKLGNYTEAVADA
NKAIGLDPTMHKAYYRKGAACIKLEEYQTAKAALELGSSYAPGDSRFTRLLKECDECIAE
ESSQAPAKNVEAPVAATVEDKEDVANMDNTPPVVEPPSKPKYRHDYYNSATEVVLTIYAK
GVPADSVVIDFGDQMLSVSIEVPGEEPYHFQPRLFSKIIPEKCKYQVLSTKVEIRLAKAE
QVTWTTLDYSGRPKAIPQKISTPAETAPRPSYPSSKSKKDWDKLEAEVKKEEKEEKLEGD
AALNKFFRDIYKDADEDMRRAMDKSFRESNGTVLSTNWKDVGSKTVEASPPDGMELKKWE
I*

Other information
Ka divergence:0.0448578KaKs divergence:-0.335041
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1086Length 2 (bp):1086Length divergence:0
MFE 1 (kcal):-338.78MFE 2 (kcal):-329.4MFE divergence-0.014