Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G105224-GRMZM2G139160
Species:maize
Duplication type:WGD
Function (paralog1):nucleic acid binding protein
Function (paralog2):C2H2 zinc finger protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.67833330888605
Log2 mRNA fold difference:1.1031271652043
Log2 TE fold difference:-0.97878891916872
Sequences
Protein sequence

MSERRRRASAASLGGGGGGGVGGVAPARAEEDKVAAPGKAPPPTVWFAFKRSLHCRSEPS
EVHVPRAKAGPVAGGGAGAAVGGGHLSSIVTKRAARSGCSRSIANLRDVIHGSKRHPGQP
PSCSPRSIGSSEFLNPIAHEVVLSTNSRCELKITGFGGCGGLAAVGVGTGAANDADGGGD
GGVVSSFVGTLRPGTPGPAWAGHGLPYSGSVRGSVRCTPPRSPNVMLERNGSVVNGHRAS
CDETAKNGASKGSGGLSCHKCGEQFSKWEALEAHHLSKHAVTELVEGDSSRKIVEIICRT
SLLKSESSCVRIERVFKVHNTQRTLSRFEEYREAVKLKASKLAKKHPRCLADGNELLRFH
GATLSCALGGGSGSSSLCASDKCAVCRIIRHGFSARKEGKGGVGVFTTSTSGRAFESIVE
APPAIGVGDDDGAGQLGLGTARRALLVCRVIAGRVHKPLDNLKEFVGQTGFDSLAGKVGP
YSNIEELYLLNPRALLPCFVVICRP*

MGERRRRASTASLGGGGGAGGSGAVPARNEEDKAAEPPPPTLWFALKRSLHCRSELSEVH
VPRANKASGPVVASGGHLSSIVTKRASARSGCSRSIANLRDVIHGSKRHPGQPPSCSPRS
IGSSEFLNPIAHEVVLSTNSRCELKITGFGGCGGLAAVGTGAAAAHDACGGGDGGVVSSF
VGTLRPGTPGPAWAGAGHGLPCSGSVRGGVRCTPPRSPCVLLERNGSVVSGHRASSCEET
AKDGGAGKGSGGLSCHRCGEQFSKWEALEEHHLSRHAVTELVEGDSSRKIVEIICRTSLL
KSESSCVRIERVFKVHNTQRTLSRFEEYREAVKLRASKLPKKHPRCLADGNELLRFHGTT
LSCALGGGGGGGGGSSRLCASDKCAVCRIIRHGFSGRKEGKTGVGVFTTSTSGRAFESIE
AAGADGAGAGSVSGTTRRALLVCRVIAGRVHKPLDNLKEFAGQTMGFDSLAGKVGPYSNI
EELYLLNPRALLPCFVVICKP*

www.000webhost.com

Other information
Ka divergence:0.308473KaKs divergence:0.220466
GC content 1 (%):70GC content 2 (%):71GC content divergence:0.007
Length 1 (bp):1518Length 2 (bp):1506Length divergence:-0.004
MFE 1 (kcal):-805.12MFE 2 (kcal):-828.61MFE divergence0.014