Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G105253-GRMZM2G158679
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100194277
Function (paralog2):pollen-specific kinase partner protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.62899991932688
Log2 mRNA fold difference:-0.41019288483586
Log2 TE fold difference:-0.25024700772446
Sequences
Protein sequence

MATASEDEAASDRCSGSYSPSADVSESETSSDCSAPTTRRFASSSSASASASATVSRRLA
SSSSSLPTPASAAAFYLSKPPSSDLSEIDMMKERFAKLLLGEDMSGSGKGVCTALAISNA
ITNLSATVFGELWRLEPLAKARKAMWTREMEWLLSVSDSIVELTPSIQELPEGGGQFEVM
VPRPRTDLYMNLPALKKLDAMLLAMIDGFKGTEFWYVDRGVMVEDSGGPFPSSSSSSSCG
RPSVRQEEKWWLPCPRVPPKGLSEDSRRKLQQSRDCANQILKAAMAINSDVLAEMEIPEM
YLETLPKSGKSCLGEIIYRYITAEQFSPECLLDCLDLSSEHHTLEVANRIEAAIHVWKLK
GQKNSTPQARSKKSWGGKVKGLVGDKEKSHTLSERANGLLQSLRLRYPGLPQTSLDMNKI
QYNKDVGQSILESYSRVLESLAFNIIARIDDVIYVDDATKKSAAAESVSIFNRGTGVPIQ
KRISLSPFSIQNTPYASPFATPTFCSSTPVTCSPGRVQPPLNKTNLGRPEIKVEKLFSGD
LEKVWTYAGNLSARKDAGDAPERD*

MATASEDEAASDRCSGSYSPSADVSESETSSDCSAPTTRRFASSSSASATVSRLASSSSS
LPTPASAAAFYLSKPTPDLSEIDMMKERFAKLLLGEDMSGSGKGVCTALAISNAITNLSA
TVFGELWRLEPLATARKAMWTREMEWLLSVADSIVELTPSIQELPEGGGQFEVMVPRPRS
DLYMNLPALKKLDAMLLAMIDGFKDTEFWYVDRGVMVEDSGGPFPSSSSSSCGRPSVRQE
DKWWLPCPRVPPKGLSEDARRKLQQSRDCANQILKAAMAINSDVLAEMEIPEVYLETLPK
NGKSCLGEIIYRYITAEQFSPECLLDCLDLSSEHHTLEVANRIEGAIHVWKLKGQKKSTP
QAKSKISWGGKVKGLVGDKEKSHTLSERADGLLQSLRLRYPGLPQTSLDMNKIQYNKDVG
QSILECYSRVLESLAFNIIARIDDVIYVDDATNRSAAAESVSIFNRGTGVPVQKRISPSP
FSIQNSPYGSPFATPTFCSSTPVTGSPGRVQPPLNKNILGTQEIKVEKLFSGDLEKVWTY
AGNLSARKDAGDAPERD*

Other information
Ka divergence:-0.157187KaKs divergence:-0.310263
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):1695Length 2 (bp):1674Length divergence:-0.006
MFE 1 (kcal):-627.9MFE 2 (kcal):-639.03MFE divergence0.009