Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G105319-GRMZM2G323024
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100382191

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.0622548269013
Log2 mRNA fold difference:5.7810835809467
Log2 TE fold difference:0
Sequences
Protein sequence

MSSSLVSTPFAAAAQKQLLAAPVPLHSFLLSSRRQQPRRAGAIRCAVAGGNGLFTQTKPE
VRRVVPADPRGLPRVKVVYVVLEAQYQSSVTAAVQQLNADPRRAASFEVVGYLPRRPRRR
QRLHRLPHLRRGAGAQGQGRGREGARPHGRRPCLPLHARGHAPQQARLLQHVAAGAVQEP
LLPALQAQQVQLQQLRRQHAQARAHAAQGAQVPALRQGAGRLAVHPQPPVLARRLGGQPP
ELPQDDRRILLAGA*

MSSSLVSTPFAAAAQKRLLAAPVPLHSFLLSGRRQPPRRAGTIRCAVAGGNGLFTQTKPE
VRRVVPSDPRGLPRVKVVYVVLEAQYQSSVTAAVQQLNADPRRAAAFEVVGYLVEELRDE
DTYATFCADLADANVFIGSLIFVEELALKVKAAVEKERDRMDAVLVFPSMPEVMRLNKLG
SFSMSQLGQSKSPFFQLFKRNKANSSNFADSMLKLVRTLPKVLKYLPSDKAQDARLYILS
LQFWLGGSPDNLQNFLKMIAGSYVPALKGAGIKYDDPVLYLDSGIWHPLAPTMYEDVKEY
LNWYGTRRDANDRLKDPKAPIIGLVLQRSHIVTGDDGHYVAVIMELEAKGAKVIPIFAGG
LDFSGPTQRYLVDPITGKTFVNAVVSLTGFALVGGPARQDHPKAIAALQKLDVPYIVALP
LVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFAGRDPRTGKSHALHKRVEQLC
TRAIRWAELKRKTKEEKRLAITVFSFPPDKGNVGTAAYLNVFSSIYSVLSDLKKDGYNVE
GLPDTPEALIEEVIHDKEAQFNSPNLNVAYRMNVREYQSLTSYASLLEENWGKPPGHLNS
DGENLLVYGKQYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYTFVEKIFQADAV
LHFGTHGSLEFMPGKQVGMSDACFPDSLIGNIPNIYYYAANNPSEATVAKRRSYANTISY
LTPPAENAGLYKGLKQLSELISSYQSLKDTGRGPQIVSSIVSTAKQCNLDKDVPLPEEGE
ELPPKERDLVVGKVYAKIMEIESRLLPCGLHVIGEPPSAIEAVATLVNIAALDRPEDGIT
SLPGILAATVGRDIEDVYRGSDKGILADVELLRQITEASRGAITAFVEKTTNSKGQVVNV
ANNLSKILGFGLSEPWVQYLSATKFVRADREKMRVLFGFLGECLRLVVQDNELGSLKLAL
EGSYVEPGPGGDPIRNPKVLPTGKNIHALDPQAIPTTAALKSAKIVVDRLLERQKADNGG
KYPETVALVLWGTDNIKTYGESLAQVLWMIGVRPVADTFGRVNRVEPVSLEELGRPRIDV
VVNCSGVFRDLFINQMNLLDRAVKMVAELDEPAEMNYVRKHAQEQAEELGVSLREAATRV
FSNASGSYSSNVNLAVENASWTDEKQLQDMYLSRKSFAFDSDAPGAGMKEKRKAFELALA
TADATFQNLDSSEISLTDVSHYFDSDPTKLVQGLRKDGRAPSSYIADTTTANAQVRTLSE
TVRLDARTKLLNPKWYEGMMKSGYEGVREIEKRLTNTVGWSATSGQVDNWVYEEANSTFI
EDEAMRKRLMDTNPNSFRKLVQTFLEASGRGYWETTEENLDRLRELYSEVEDKIEGIDR*

Other information
Ka divergence:-1KaKs divergence:-0.952381
GC content 1 (%):67GC content 2 (%):61GC content divergence:-0.047
Length 1 (bp):765Length 2 (bp):4140Length divergence:0.688
MFE 1 (kcal):-341.31MFE 2 (kcal):-1802.38MFE divergence0.682