Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G105466-GRMZM2G156803
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100304324
Function (paralog2):hypothetical protein LOC100383821

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.1558392638848
Log2 mRNA fold difference:-0.58026925372943
Log2 TE fold difference:-0.56347695241751
Sequences
Protein sequence

MPSIAPPSSSVAALTRQPVQFFKGCSVSKETKGPVRSFFTANSKSTKVKSAGLKVASSFK
NDGGYPAGGVSWKDDTLLPKSTTIRGQDHSVADPVLPMDSMITPEILSANVERVIDMFAD
DDTDTELDLDSPTEGFTSIAEAIEDIQQGKLVIVVDDESRENEGDLIMAASLVTPEAMAF
IVRHGTGIVCVSMKEDDLERLSLPLMVTTKENEEKLCTAFTVTVDAKEGTTTGVSAKDRA
KTVMTLASPDSKPEDLNRPGHIFPLKYREGGVLKRAGHTEASVDLAMLAGLPPVAVLCEI
VDDADGSMARLPKLRVFAEKENLKIISIADLIRYRRKRDRLIERASVARLPLKWGNVHAY
CYKSVIDGIEHIAMVKGDIGDGQDILVRVHSECLTGDIFGSARCDCGDQLAMAMEMIEKA
GRGVLVYLRGHEGRGIGLGHKLRAYNLQDDGRDTVEANEELGLPVDSREYGIGAQILRDL
GVRSMKLMTNNPAKYSGLKGYGLSIAGRVPLITPITSENRRYLETKRTKMGHVYGLANAQ
ANLANGSQSTEENH*

MASIPPPSSSVAALTRQPAQFLKWCSVSKETKASVCSFLATNSNSTRVKSVGLRVALSFK
NDGGYPADGFSGNGNTLLPKSTSVRGEDHPVADPVLPMDSMMTPEILSANLALVMDKFSD
DDTDTELDLDSPTEGFASIPDAIEDVRQGKLVIVVDDESRENEGDLIMAASLVTPEAMAF
IVRHGTGIVCVSMKEDDLERLSLPLMVTTKENEEKLCTAFTVTVDAKEGTTTGVSAKDRA
KTVMTLASPDSRPEDFNRPGHIFPLKYREGGVLKRAGHTEASVDLAMLAGLPPVAVLCEI
VDDADGSMARLPKLRVFAERENLKIISIADLIRYRRKRDRLVERASVARLPSQWGNGHGY
CYRSAIDGIEHLAMVKGDIGDGQDILVRVHSECLTGDIFRSARCDCGDQLAMAIEMIEKA
GRGVIVYLRGHEGRGIGLGHKLRAYNLQDDGRDTVEANEELGLPVDSREYGIGAQILRDL
GVRSMKLMTNSPAKYSGLKGYGLSIAGRVPLVTPITSENRKYLETKRTKMGHVYGLANAQ
VNQPSGSQSTEEKH*

Other information
Ka divergence:0.0904456KaKs divergence:-0.116902
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1665Length 2 (bp):1665Length divergence:0
MFE 1 (kcal):-548.91MFE 2 (kcal):-549.14MFE divergence0