Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G105531-GRMZM2G100402
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281827
Function (paralog2):mitochondrial import receptor subunit TOM20

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEMGGMSDAERLFFFEMACKNSEVAYEQNPNDADNLTRWGGALLELSQVRTGPDSLKLLE
DAEAKLEEALQIDPNKSDALWCLGNAQTSHGFFTPDNAIANEFFTKATGCFQKAVDVEPA
NELYRKSLDLSMKAPELHLEIQRQMVSQAATQASSASNPRQSRKKKDNDFWYDVCGWVIL
GAGIVAWVGLARASMPPPTPPAR*

MEMSDAERLFFFEMACNNSEVAYEQNPNDADNLTRWGGALLELSQMRNGPDSLKLLQDAE
AKLEEALQIDPNKSDALWCLGNAQTSHGFFTPDTAMANEFFAKATECFQKAADVEPANEL
YRKSLDLSAKAPELHSEIHRQMASQAATQASSASNPTQSRKKKKKDNEFWYDVCGWVILG
AGICAWVGLARASMPPPSAPAT*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):53GC content divergence:0
Length 1 (bp):612Length 2 (bp):609Length divergence:-0.002
MFE 1 (kcal):-211MFE 2 (kcal):-210.5MFE divergence-0.001