Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G105604-GRMZM2G000739
Species:maize
Duplication type:WGD
Function (paralog1):siroheme uroporphyrinogen methyltransferase1
Function (paralog2):hypothetical protein LOC100217089

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MALAVRTPRFQPRPASISAPTTPASTSLAAGNARPRPCAGAAVRASPFTEATSSSRYRRD
AWSYAADGSSNSASPSSAAAAAAGRRDDEIALQLPELRRLLDVLRASRGRGAEEGGGPGR
VALVGTGPGDPELLTLKAVRAIEAADLVLYDRLVSNDVLDLVGEGARLLYVGKTAGYHSR
TQEEIHELLLSFAEAGANVVRLKGGDPLVFGRGGEEMDFLQQQGIKVEVIPGITSASGIA
AELGIPLTHRGVATSVRFLTGHSRNGGTDPLYVAGNAADPDTTLVVYMGLSTLPSLAPKL
MKHGLPPDTPAVAVERGTTPQQRTVFASLKDLVDEVKSADLVSPTLIIIGKVVSLSPFWV
ESSEHDALKVQSSYANEADDNRFSWFLVTGQYLRNARSQIWEHRFDLVYTETSQEAWILN
GGW*

MALAVRTPRFQPRPASISAPATPASNSLAAAAAANARPRTCAGAAVRASPFTEATSSSRY
LRDAWSYATDCSSNSASRSSDAAAAAAALGRRDDEIALQLPELQRLLDALRASRRRGAEG
GGGGGRGPGRVALVGTGPGDPELLTLKAVRAIEAADLVLYDRLVSNDVLDLVGEGSRLLY
VGKTAGYHSRTQEEIHELLLSFAEAGANVVRLKGGDPLVFGRGGEEMDFLQQQGIKVEII
PGITSASGIAAELGIPLTHRGVATSVRFLTGHSRNGGTDPLYVAGNAADPDTTLVVYMGL
STLASLAPKLMKHGLPPDTPAVAVERGTTPQQRMVFALLKDLVDEVKSADLVSPTLIIIG
KVVSLSPFWVESSEHDALKIESSYASEAR*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):58GC content 2 (%):59GC content divergence:0.009
Length 1 (bp):1272Length 2 (bp):1170Length divergence:-0.042
MFE 1 (kcal):-522.4MFE 2 (kcal):-495.49MFE divergence-0.026