Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G105999-GRMZM2G013892
Species:maize
Duplication type:WGD
Function (paralog1):ubiquitin-protein ligase/ zinc ion binding protein (LOC100282619), mRNA
Function (paralog2):hypothetical protein LOC100194198

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

GNKRQRVVAVDHLSPDWGAGSSLQPNGVQTGKEPAKEVPKEPSFTCPICWNKMEEPSTTT
CGHIFCDTCIKQAIKVQKKCPTCRKGLKMNSVHRIFLPNASS*

MNTVSGTKRAPRRQSQDGSGDKLVVIVEASSRGVGSRRGPHAPIPGALNSPIDVEAIEDE
VQAVSPSRVPLPCILQRRNRRTRREPITVVDLEVEASREGSKRQRVEPVGRHLYPDWGAR
SSLQSNAAQTSKEPAKEVPEEPSFTCPICWNKMEEPSTTTCGHVFCDTCIKQAIKVQKKC
PTCRKGLKMNSVHRIYLPNGSS*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):52GC content divergence:0.03
Length 1 (bp):309Length 2 (bp):609Length divergence:0.327
MFE 1 (kcal):-97.16MFE 2 (kcal):-203.8MFE divergence0.354