Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G106061-GRMZM2G407996
Species:maize
Duplication type:WGD
Function (paralog1):elongation factor Tu
Function (paralog2):LOC100283194

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.1208658249603
Log2 mRNA fold difference:-1.7371259545189
Log2 TE fold difference:0.61617225631614
Sequences
Protein sequence

MASLTSASTSLLFPQASSSRSRVRLSTSLGFSAQPARLRSRAAAGGQRRGSLLVVRAARG
KFERTKPHVNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYDEIDAAPEERARGITIN
TATVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILLAK
QVGVPKIVVFLNKKDMVDDEELLELVELEVRELLSNYEYDGDEVPIVAGSALKALEALMG
NPTLKRGDDEWVDCIFKLVDSVDSYIPVPQRQTDLPFLLAVEDVFSITGRGTVATGRIER
GTVKIGDTVDIVGIRDTRNCTVTGVEMFQKTMDDAMAGDNVGLLLRGMQKDDIERGMVLA
KPGSITPHTKFEAVVYVLKKEEGGRHSPFFPGYRPQFYMRTTDVTGNVTVIMNDKDEEAK
MCMPGDRIKMVVQLIQPVACEQGMRFAIREGGKTVGAGVINKIIE*

MASLTSASTSLLFPQASSSRSRIRLSTPLGFSAQPARLRSQGAAVGARRRGRLLVVRAAR
GKFERTKPHVNIGTIGHVDHGKTTLTAALTMVLASVGGSAPKKYDEIDAAPEERARGITI
NTATVEYETETRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSGADGPMPQTKEHILLA
KQVGVPKIVVFLNKKDMVDDEELLELVELEVRELLSNYEYDGDDVPIVAGSALKALEALM
VNPALKRGDDEWVDYIFSLVDKVDSYIPVPQRQTDLPFLLAVEDVFSITGRGTVATGRIE
RGTVKIGDTVDIVGIRDTRNCTVTGVEMFQKTMDDAMAGDNVGLLLRGMQKDDIERGMVL
AKPGSITPHTKFEAVVYVLKKEEGGRHSPFFPGYRPQFYMRTTDVTGSVTTIMNDKDEEA
KMCMPGDRIKMIVQLIQPVACEQGMRFAIREGGKTVGAGVINKIIE*

www.000webhost.com

Other information
Ka divergence:0.169524KaKs divergence:-0.0097629
GC content 1 (%):60GC content 2 (%):59GC content divergence:-0.008
Length 1 (bp):1398Length 2 (bp):1401Length divergence:0.001
MFE 1 (kcal):-589.8MFE 2 (kcal):-567.14MFE divergence-0.02