Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G106133-GRMZM2G004878
Species:maize
Duplication type:WGD
Function (paralog1):high mobility group I/Y-2
Function (paralog2):hypothetical protein LOC100277576

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MATDEATKPSPIPPYPEMILAAIEGLDDKSGSNKSAISKYIEGKYGSLPPAHASLLTAHL
ARMKESGELVFLKNNYFRAGAPDAPPKRGRGRPPKARDPNAPAPAPKSPSSTGRGRGRPP
KAKSPLEAAVKQATAGMPKPRGRPPKKAKTDGAASPSPSPAPAPAGDGSTPGKRGRGRPP
KVRPAVPSETAAA*

MATEEVAKPSPIPPYPEMILAAIEDLGDKSGSNKSAISRYIEGKYDGDLPPAHASLLAAH
LARMKESGELVFVKNNYFRADAPDAPPKRGRGRPPKARDPGAPVSPPSGRGRGRPPKPKD
PLDAAVKQATAGMPRARGRPPKKAKTEGGASPAPAGDGSTPVKRGRGRPPKVRPVVPSET
AAA*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):74GC content 2 (%):75GC content divergence:0.007
Length 1 (bp):582Length 2 (bp):552Length divergence:-0.026
MFE 1 (kcal):-271.12MFE 2 (kcal):-298.67MFE divergence0.048