Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G106393-GRMZM2G106413
Species:maize
Duplication type:TD
Function (paralog1):LOC100280530
Function (paralog2):LOC100282066

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.5820678842377
Log2 mRNA fold difference:1.5702613473947
Log2 TE fold difference:0.34005076149311
Sequences
Protein sequence

MAGAAKASWMVAMSVGAVEALKDQGGLCRWNYALRSVHRTAKANVRSSLAAQRDKELAPA
AESKRRPGKAAAEEGMRTVMYLSCWGPN*

MAAAAATKASSWMVAMSVGAVEALKDQGGLCRWNYALRSVYRTAKANVRSGSRSFAAQRD
KDLAPAAEKGRQDKAAAEEGLRTVMYLSCWGPN*

Other information
Ka divergence:1KaKs divergence:0.999321
GC content 1 (%):71GC content 2 (%):68GC content divergence:-0.022
Length 1 (bp):267Length 2 (bp):282Length divergence:0.027
MFE 1 (kcal):-139MFE 2 (kcal):-138.2MFE divergence-0.003