Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G106790-GRMZM2G151983
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100193939
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.051601180209519
Log2 mRNA fold difference:2.0487887803485
Log2 TE fold difference:-2.1108982804977
Sequences
Protein sequence

MAAVKASEARGDPPLLQVVELSRIVAVEGAGTLSSADLARILVSNLCFAHNSPSLWKLLG
QAVVSRLLCPLHVLALLTPRVLPQRRAQPEAYRLYLELLKCHVTSSLLSMEAGPNRDKIG
KSIAEALQLSKVYGFSGTEFGHVVIMFVLAVVSKLIDSIFEDCGFPSAMVEGQESVNAID
GPQPMDLDVKMGSTENQNEHREQLRRKNTLIALDVLHMMTADRKIQSFLRLIFLNMPERF
SSLRQRLSSIEAQKVSLETLLPSGHKINELLINFWRVCKTDYQPNNKHILGVLGNMGSGG
SLLGQLTGAGRPACWIIFDIYVENAIDGRHLSVISAIRIIKEMTKTMQVLNEASWQETFK
ALWISALRLVQRAREPLEGPIPHLDARLCMLLALIPLSVAAILQEESDMLGAEGNKILPQ
RQGLISSLQDLIQYSGLLVPPSSVVNAANAAASKAAIFKANYEAGVGNSSMMDQTDSSMK
AAGNMLHLIIEACISRKLIDTSAYLWPGYVVPSGTLKDTALPQESPWLNFMKGSRLSGPL
IDALVASPASSVAELDKLYSIALNGSEEEKTAAAKILCGASLVRGWNIQEHVVGMVVKLL
SASLPSDSATSTPGSMSNYLAHMSTLNEILLGVSYGDAIHILSLYGMVPDVAVALMPICE
AFGSIPPPPNHKSTILGEISVYTVFSCAFLCLLRLWKFYRPPQEYCLAGRGGSVKLELTL
DYLLLMHNNHIEFSNSSASNRDSCNDMGSVNEVPAQLIYIDSFPKLRAWYFQNQACIASP
LSGLCNKNPVHQVANKILNMICRKMNKGVVSSSTLSSTSSSSVSGSSVSASDDPCQRPAV
SGWEFLEAVPFVLEAVLTACAHGQLSSRDLTTSLRDLVDFLPASLAAIVSYFSAEITRGI
WKPVPMNGIEWPSPGASLHSIEAEVKEILASAGVQINSCYPRGVPPMLPLPMAALVSLTI
TFKLDRSLEYIQGVIGQALENCAGGSSWPSMPIIGALWTQKVRRWHDFIVLSCMRSPFGR
DKDAVAQLIQSCFSSFLQSSSSGSDIIANRGVGALLGDSITNQGLRLPMAPGFIYLRTCR
TFHDTYFVSEVILKQVIEWAHKLANGWCFNGPPQLKSGRTPLSCAASMVQQVALLGGGLL
CIAGGPLVVQVLYEETLPTLLLSARDQSLKGPGPVSSTLQGYAMANMLFYCGSLLWGADR
TSPVMKLSFLSRRPRVVRTHMDFIAGVLDGHILLGCDPGTWKAYVSQFMFLVVKFVPSWL
RDIKLDTLKKIAAGLRSWHEHDLALSLLERGGPQAISVVVETFL*

MEAVKASEARRDPPLLRAVELSRVVAEEGAGAELAGILVSNLCFAHNSPSLWKLLGQAVA
SRLLCPLHVLALLTPRVLPQRRAQPEAYRLYLELLKCHATSSLLAMEAGPNRDNILEDCG
FPSVMAEGQESVYAIEGPQPMDLDIKRGSTENQNEHREQLRRKNTFMALDVLHMMAADRK
IQSFLSLIFLNMYIFSYPFSRWSSMYYPPMDKFNFNWLQLRVRPEKFSSLRQRLSSIEAH
KVTLETLLPSGHKINDLLINIWRVCKAGYQPNNKHILGVLGNMGSGGSLLGQLTGAGRPA
CWIIFDIYVENAIDGKHLSVTSAIGIIKEMTKTMQVLNEASWQETFKALWISTLRLVQRA
REPLEGPIPHLDARLCMLLALIPLSIAAILQEESDMFGVEGNKILPQRQGLISSLQDLIQ
YSGLLVPPSSVVNAANAAASKAAIFKANYKAGAGNTSMMDQTDSSMKAAGNMLHLIIEAC
ISRKLIDTSAYLWHGYVVPSRTLKDTALPQESPWLNFMKGSQLSEPLIDALVATPASSVA
ELDKLYSVATNGSEEEKTAAAKILCGASLVRGWNIQEHVVSMVVKLLSASLPSDSSTSTP
GSMSHYLAHMSTLNEILLGVSYGDVIHILSLYGMVPDVAVALMPLCEAFGSIAPPPNHKS
TILGETSVYLVFSCAFLCLLRLWKFYRPPQEYCLTGRGGSVKLELTLDYLLLMHNNRIFS
NSSAPNRDSYNSMGSVNEVSAQPIYIDSFPKLSAWYFQNQACIASTLSGLCNKNPVHQVA
NKILNMICRKMNKGGVSSSNLSSTSSSSVSGSSVSASDDSYQRPAVPAWEFLEAVPFVLE
AVLTACAHGRLSSRDLTTSLRDLVDFLPASLAAIVSYFSAEITRGIWKPVPMNGTEWPSP
GASLHSIEAEVKEILASAGVQINSCYPRGVPPMLPLPMAALVSLTITFKLDRSLEYIQGV
IGHALENCAGGSSWPSMPIIGALWTQKVRRWHDFIVLSCMRSPFGRDKDAVAQLIRSCFS
SFLQSSSSGSDIIANRGVGALLGDSITDQGLRLPMAPGFVYLRTCRTFHDTYFVSEVILK
QVIEWAHKLANGWSFNGPPQLKSGRTPLSCAASMAHQVAMLGGGLLCIAGGPLVVQVLYE
DTLPTLLLSAREQSLKDPGPVSSTLQGYAMANMLFYCGSLLWGADRSSPVMKLSFLSRRP
RVVRNHMDFIAGVLDGHILLGCDPGTWKAYVSQFMFLVVKFVPSWLPDIKLDTLKKIAAG
LRSWHEHDLALSLLERGGPQAISVVVETFL*

Other information
Ka divergence:-0.168215KaKs divergence:-0.258972
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):3915Length 2 (bp):3873Length divergence:-0.005
MFE 1 (kcal):-1297.81MFE 2 (kcal):-1295.94MFE divergence-0.001