Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G106810-AC203841.3
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274102
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MLVTKNFENFGQCYILTISRFSFSKKIYVICCGAGILTCVRECQTTGIIGENVISHCQFK
EDNTSVGGSWYNQEQIYIQWKELNCMTDCRYFCMTRREGERQALGLSPVKYHGKWPFLRV
SVFQEPLSAALSAVNLLMHFTGWLSFFLLVNYQLPLRPQAKRTYYEYTSLWHIYAILSMN
AWFWSSIFHTRDIDLTEKLDYSSAVALLGYSLILSLLRAFNVKDEASRVMFAAPILAFVT
THILYLNFYELDYGWNMKVCVVMAAVQLLTWAVWAGVSRHPSRLKVWTVVFGGALAMLLE
LYDFPPYMGYADAHSLWHASTIPLTCLLWSFIKDDAKFRTATLVKKAK*

MATIALPSPPLPHRTIPPVAPSVSPPNSASASLKRLCKEGDLRQALRQLTTRAPPAREHY
GWVLDLVAARRAAAEGRQVHAHAVTTGSLNEDDDGFLATKLVFMYGRCGRVDDARRLFNG
MPARTVFSWNALVGAYLSSGSAGEAMRVYGAMRASAAPGSAPDGCTLASVLKACGAEGDG
RCGGEVHGLAVKVGLDKSTLVANALIGMYAKCGLLDSALRVFEWLQQDARDVASWNSVVS
GCVQNGRTLEALALFRGMQSAGFPMNSYTSVAVLQVCAELGLLSLGRELHAALLKCGSEL
NIQCNALLVMYAKYGRVDSALRVFGQIAEKDYISWNSMLSCYVQNSFYAEAIDFFGEMLQ
HGFQPDHACVVSLSSALGHLSRLNNGREFHAYAIKQRLHTDLQVGNTLMDMYIKCGSIEC
SAKVFESMGIRDHISWTTILACFAQSSRHSEALEMILELQKEGIMVDSMMIGSILETCCG
LKSISLLKQVHCYAIRNGLLDLILENRLIDIYGECGEFDHSLNLFQRVEKKDIVSWTSMI
NCCTNNGRLNGAVFLFTEMQKANIQPDSVALVSILVAIAGLSSLTKGKQVHGFLIRRNFP
IEGPVVSSLVDMYSGCGSMNYAIRVFERAKCKDVVLWTAMINATGMHGHGKQAIDLFKRM
LQTGLTPDHVSFLALLYACSHSKLVEEGKHYLDIMVSKYRLKPWQEHYACVVDILGRSGQ
TEEAYEFIKTMPMDPKSAVWCALLGACRVHRNYGLAVVAANKLLELEPDNPGNYILVSNV
FAEMGKWNNAKETRTRMAERGLRKNPACSWIEIGNNIHTFTSGDYCHRDSEAIHLKLSEI
TEMLRREGGYVEDTRFVLHDTSEEEKIDMLHKHSERIAIAFGLISTRPGMPIRIAKNLRV
CGDCHEFTKLVSKLFERDIVVRDANRFHHFSGGSCSCEDFW*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):46GC content 2 (%):51GC content divergence:0.052
Length 1 (bp):1047Length 2 (bp):2826Length divergence:0.459
MFE 1 (kcal):-325.6MFE 2 (kcal):-1050.68MFE divergence0.527