Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107065-GRMZM2G333095
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277591 (LOC100277591), mRNA
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:3.1010954523558
Log2 mRNA fold difference:0.35740061278641
Log2 TE fold difference:2.740865330027
Sequences
Protein sequence

MMSSSSGIKQEGPKLFSSRRILARDRSSVAVADASFRVYYSLGAGTVPFLWESKPGTPKS
SVTPPAPASSTAGAVPVPPISPPPSYQQAVSRSKANKFARKQRPARTSWPPAGWIIGWLS
LNVRRRSPPSSSPTDHQQRCVARNEHGVVVVDGDDERRSPRSSTLCF*

MTMSSSSINKQEGPKLFSSRILSRDRSSVANASFRVYYSLGAGTVPFLWESKPGTPKSSS
TPASGASAVPPISPPPPYQQKPVSQSMADKAKFRRRRPAASSWPPGGCWIIGCLNLNVRR
RSPQPSPTDHQQRRCLGVVDGDERRSRRSTMCF*

Other information
Ka divergence:-0.189571KaKs divergence:-0.480351
GC content 1 (%):67GC content 2 (%):64GC content divergence:-0.023
Length 1 (bp):504Length 2 (bp):462Length divergence:-0.043
MFE 1 (kcal):-239.2MFE 2 (kcal):-207.4MFE divergence-0.071