Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107106-GRMZM2G134770
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272869
Function (paralog2):LOC100280526

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:3.9591720672279
Log2 mRNA fold difference:0.98659065977021
Log2 TE fold difference:2.9725825447063
Sequences
Protein sequence

MSSQVDRRSQSAGKRARTDGSRREDDWVCPSCKNVNFAFRTTCNMRSCNQSRPADHTKAM
QTPPHYPTSGGYMGPGTPPSMYLGGGAPPYGSSMFNGPAVTRYGIPQFPGGSAYSYGYGG
PIPMGSPYGPMQIAGPTPYSGGTMMTAGGMYGIPMDRYGPIPAGPGPMGTRAGSYSDEGS
QKKPAGAGRDNDWECPNCHNINFGFRTVCNMRKCNTPRPANQGSKSDGLRGSKAKMPEGS
WKCEQCNNINYPFRTKCNRPQCGAEKPSQTNNVNGSATDQDNQFLPCNITKLLSKLRLLH
EFQDSSEQTDLPCPTAGSPTLRMSALSELQNSLSN*

MSSQVDSRSQSAGKRARTDGSRREDDWVCPSCKNVNFAFRTTCNMRNCNQSRPADHTAMQ
TPPRYPTSGGYMSPGTPPSMYLGGGAPPYGSSMFNGPAMTRYGITQFPGGSAYPYGYGGR
ISMGSPYGPMQMAGPTAYSGGSMMGAGGMYGMPMDRYGLIPAGSGPMGTRAGSYSDEDSQ
KKSAGAGRDNDWECPNCHNINFGFRTVCNMRKCNTPRPENQGSKPDGLRGSKPKTPEGSW
KCEQCNNINYPFRTKCNRPQCGAEKPSQTNNANESAEDQDNQVFVSEPSLWSSTFSTPLF
RTLSCMPY*

www.000webhost.com

Other information
Ka divergence:0.177223KaKs divergence:-0.0659624
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):1008Length 2 (bp):927Length divergence:-0.042
MFE 1 (kcal):-350.5MFE 2 (kcal):-307.53MFE divergence-0.065