Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107163-GRMZM2G131957
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.91221736600991
Log2 mRNA fold difference:0.90634105081616
Log2 TE fold difference:0.010165934961719
Sequences
Protein sequence

MDPAGDPAFHRNEAISAVQDVDQYYGDDDDFDDLYNDVNVGDGFLHASHQAPPPRPPTQQ
APPPQQLHPPPQQQPPPPPQQQPPAHTLPPPPPHVPPPPQQVRIPGVAVPAPGIPPGQTN
LHPPPQPLAAPAPPPAQHHQIQQGDGFHRSGGNFAGGPIVVGNGGAAGGGDGPGGTTLFV
GELHWWTTDADLESELIKYGSVKEVRFFDEKASGKSKGYCQVDFYDPGAAAACKEAMNGH
TFNGRPCVVAFATPNSVRRMGEAQVKNQQAMAAQTSNMQPKGGRGGGGAAGPQVGGNYGG
GRGGAVGSGAGGGAGGGGGNWGRGGGGMGNRGPVGNMRNRMGPAGGGRGIMGNGGMVAPP
PPMMPPGGMLGQGFDPAGYGAMGRMGGGFGGFPGGPGAMPFPGLMQPFPPVVAPHVNPAF
FGRAGMGAGGMWPDPNMGAWGGEEQSSYGDDAASDQQYGEGGSHGKERPPEREWSGVPER
RREREKDAPPAQEWPERRHRDERDMDRERNRDYDRDRERDRDRERDRDRDRERERERDRD
RERERHKDDRDRYGDNHRHRDRDSERNEDWDRGRSSGIRSRSREADHSKRRRMTPQ*

MDPDGDPAFHRNEAISAVQDVDQYYGDDDDFDDLYNDVNVGDGFLHASHQAPPPLPPPPP
TQQAPPPQKHQLPPPSQQLPPPQQHPPAHVLPPPPPQAPPPQQQVSIPGVAVPAPGRPPA
QTNLPPPPQPPAAPAPPPPPQHHHIQQDGINRPGGNIAGGPIVVGNGGPAGGGDGPGGTT
LFVGELHWWTTDADLESELSKYGPVKEVRFFDEKASGKSKGYCQVDFYDPGAAAACKEGM
NGHTFNGRPCVVAFATPNSVRRMGEAQVKNQQAMAAQTSNMQPKVGRGSGGAAGPQAGGN
YGGGRGGPVGPGAGGGAGGGGGNWGRGGGGMGNRGPIGNMRNRMGPAGGGRGIMGNGGMV
APPPPMMPPGGMLGQGFDPTGYGAMGRMGGGFGGFPGGPGAMPFPGLMQPFPPVVAPHVN
PAFFGRGGMGAGGMWPDPNMGAWGGEEQSSYGDDAASDQQYGEGGSHGKERPPEREWSGA
PERRREREKDAPPAQEWPERRQRDERDMDRERNRDYDRDREKDRDRERDRDRDRERDRDR
ERERERERERERHRDDRDRYGDYHRHRDRDSERNEDWDRGRSSGIRGRSREADHSKRRRM
TPQ*

Other information
Ka divergence:-0.144645KaKs divergence:0.291347
GC content 1 (%):63GC content 2 (%):62GC content divergence:-0.008
Length 1 (bp):1791Length 2 (bp):1812Length divergence:0.006
MFE 1 (kcal):-787.94MFE 2 (kcal):-787.2MFE divergence0