Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107196-GRMZM2G030139
Species:maize
Duplication type:WGD
Function (paralog1):pyruvate dehydrogenase (lipoamide) kinase1
Function (paralog2):hypothetical protein LOC100193944

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASEPVARAVAEEVARWGAMRQTGVSLRYMMEFGARPTERTLLLAAQFLHKELPIRIARR
ALDLDSLPFGLSTKPAILKVKDWYVESFREIRSFPEVRNQKDELAFTQMIKMIRVRHTNV
VPAIALGVQQLKKDLGGPKAFPPGIHEIHQFLDRFYMSRIGIRMLIGQHVALHDPDPEPG
VIGLINTKMSPMTVARIASEDARAICMREYGSSPDVDIYGDPGFTFPYVTPHLHLMIFEL
VKNSLRAVQERYMDSDKLAPPVRIIVADGAEDVTIKISDEGGGIPRSGLSRIFTYLYSTA
ENPPDLDGHNEGVTMAGYGYGIPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSEE
PLP*

MALEPVARAVAEEVARWGAMRQTGVSLRYMMEFGVRPTERTLLLAAQFLHKELPIRIARR
ALDLDSLPFGLSTKPAILKVRDWYVESFRDIRSFPEVKNQEDELAFTQMIKMIKVRHTNV
VPAVALGVQQLKKDLGGPKAFPPGIHEIHQFLDRFYMSRIGIRMLIGQHVALHDPDPEPG
VIGLINTKMSPMTVARIASEDARAICMREYGSSPNVDIYGDPGFTFPYVTPHLHLMIFEL
VKNSLRAVQERYMDSDKLAPPVRIIVADGAEDVTIKITDEGGGIPRSGLSRIFTYLYSTA
ENPPDLDVHNEGVTMAGYGYGIPISRLYARYFGGDLQIISMEGYGTDAYLHLSRLGDSEE
PLT*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):53GC content 2 (%):52GC content divergence:-0.01
Length 1 (bp):1092Length 2 (bp):1092Length divergence:0
MFE 1 (kcal):-401.11MFE 2 (kcal):-399.57MFE divergence-0.002