Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107463-GRMZM2G402341
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100383259
Function (paralog2):hypothetical protein LOC100275703

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.61606961157814
Log2 mRNA fold difference:-0.40271759538845
Log2 TE fold difference:1.0242830547273
Sequences
Protein sequence

MDPTEPRWRINSSFSPPTSRRWDCRYSSDGLPHRVHDAPHDHPPYVSSLSSHSKGSRSAF
GSDQYLNHHHSASDGALSYFGSPADSLQAPRWTPSLQRFDLGEFSTPAGGSRPETSDYPQ
SSERPLTATSSFSSASPFSESSQLASSSKQAAPYLPRNHMGRRSFMSKPVYPLVFRNPVS
ESEACRMLEVSNAGRATPSDDSQASPLWRRSLASPELKFHNALNELGKMEVSPERNTSSR
REGFRWSNASSYDFGYDGDAIDMSDHISIESQRSPTSSVRFLKCGLCERFLCQKSPWTSN
RIVRNADMPVAAVLHCRHVFHADCLEEGTPKTEVHEPPCPLCTAPTDDEAHVSFSEPLHV
ALRSARRNLSLGSGAGGSNSSGARPPCSDRGLKRNHSAIVPRRGGGGSLFRNRFKRQFPF
KARIGKELFGGRVFSKVGSSSGQQDDHRQQAPKRDRLMK*

MDPTEPRWRINSSFSPPTSRRWDCRYSSDGLPHRVHDAPHDHPPYVSSLSSHSKGSRNAF
GSDQYLSHHHSVSDGALSYFGSPADSLQAPRWTPSLQRFDLGEFSTPAGGSRPETSDYPQ
SSERPLTATSSFSSASPFSESSQLASSSKQPAPYLPRNHMGRRSFMSKPVYPLVFRNPVS
ESEACRMLEVGNAGRATPSDDSQASPLWRRSLASPDLKFHNAPNELGKMETSPEPNTSSR
REGFRWSNASSYDFGYDGDAIDISDHISIESQRSPTSSARFLKCGLCERFLHQKSPWTSN
RIVRNADMPVAAVLPCRHVFHADCLEESTAKTEVHEPPCPLCARATDDEGHVSFSEPLHV
ALRSARRNLLLGTGAGGNSGISDPPRTDRGLKRNNSAVMPRRSGGALFRNRFKKQFPFKA
RIGKELFGGRVLNKVGLSLSSGQHDDHRQQAPKHDRPMK*

Other information
Ka divergence:0.126719KaKs divergence:0.18083
GC content 1 (%):53GC content 2 (%):52GC content divergence:-0.01
Length 1 (bp):1380Length 2 (bp):1380Length divergence:0
MFE 1 (kcal):-493.65MFE 2 (kcal):-487.83MFE divergence-0.006