Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107495-GRMZM2G128491
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100276254

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.0036004161868
Log2 mRNA fold difference:3.6448361353047
Log2 TE fold difference:-2.1067623348143
Sequences
Protein sequence

MERAAPVRSSHTSTAGLLAWPQPDGAASQAPRRPNQPTEEFRKVVFGGQVTEEADGLNKT
KMRTTASAPKSKETTGIGMFKAESAAAAVTTASRDRQASQITFSQDGTIPPRKPTSVAGV
ARQRELSHTVESSGDGKMKRQVSNAKSKELSGHNIFADHEDPSPNRSSSSAAALAHVKNA
NVSSFSFGKADMDSTVKTAKKKGSSNKSTDLMNGKAISERDSAPAGKQPLNRAKPKGLSG
SSIFADGKASTTGDHAGRRTRQPPGGDSSILLG*

MERAAPVRSSHTSTAGLLAWPHPDGAGSLPARRPNQPTEEFRNVVFGGQLTEGADGLNKT
KRKTGSSPKGKETTGTGISKAESAVATASRDRQASQITFSQDGTVPTRKATSVAGVARQR
ELSHTVESEGDSKMKRQVSSTKSKELSGHDIFADHEDPKPNRSRRSDYGSSAAQSPVKNA
NVSSFSFGEADIDSTVKTAKKKGSSNLSTDLNGKTMPKKDSASAEKQPPNRARPKGMSGS
SNFADGKASTSTTGDHEGRRTRQPPGGDSSILLG*

Other information
Ka divergence:-0.017604KaKs divergence:0.11538
GC content 1 (%):58GC content 2 (%):59GC content divergence:0.009
Length 1 (bp):822Length 2 (bp):825Length divergence:0.002
MFE 1 (kcal):-324.6MFE 2 (kcal):-327.3MFE divergence0.004