Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107540-GRMZM2G046055
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):Histone H2A

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSSTGGSGRGKAKPATKSVSRSSKAGLQFPVGRIARYLKAGKYAERVGAGAPVYLSAVLE
YLAAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGTVTIAAGGVMPNIHQNLL
PKKAGHKGDIGSASQEF*

MSSTGGGGRGKAKPATKSVSRSSKAGLQFPVGRIARYLKAGKYAERVGAGAPVYLSAVLE
YLAAEVLELAGNAARDNKKNRIVPRHIQLAVRNDEELSKLLGTVTIAAGGVMPNIHQTLL
PKKAGQKGDIGSASQEF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):65GC content 2 (%):66GC content divergence:0.008
Length 1 (bp):414Length 2 (bp):414Length divergence:0
MFE 1 (kcal):-197.24MFE 2 (kcal):-199.42MFE divergence0.005