Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107575-GRMZM2G015324
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191578
Function (paralog2):calcineurin B-like protein 9

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGCFHSTAKRQHPGYEDPVHLASQTAFSVSEVEALFELFKSISGSVIDDGLINKEEFQLA
LFKNQRKENLFANRIFDLFDVKKRGVIDFGDFVRALNVFHPNIPMEEKVDFSFKLYDMDG
TGFIERKEVKQMLIALLGESEMRLSDEIIETILDKTFSDADANQDGKIDRTEWENFVTRN
PSLMKIMTLPYLKDITTTFPSFVFNSEVDDLVT*

MGCFHSTAKRQHPGYEDPVDLASQTSFSVSEVEALFELFKSISGSVIDDGLINKEEFQLA
LFKNQRKENLFANRIFDLFDVKKRGAIDFGDFVRALNVFHPNIPMDEKIDFSFKLYDMDS
TGFIERKEVKQMLIALLGESEMRLSDDIIETILDKTFSDADANQDGKIDRTEWENFVTRN
PSLMKIMTLPYLKDITTTFPSFVFNSEVDDLVT*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):43GC content 2 (%):42GC content divergence:-0.012
Length 1 (bp):642Length 2 (bp):642Length divergence:0
MFE 1 (kcal):-174.2MFE 2 (kcal):-184.82MFE divergence0.03