Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107629-GRMZM2G067764
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100381424

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRGRNDSGNSKPVVLCCVMIVCLCLLFLYFSGSNGQAGSTAFEYGTKFSRSLGWGSDDGS
EESIFGTGDADDVKPKSFLVCDDRHSELIPCLDRNLIYQMRLKLDLNLMEHYERHCPPPE
RRFNCLIPPPHGYKVPIKWPKSRDVVWKANIPHTHLAKEKSDQNWMVEAGEKIKFPGGGT
HFHHGADKYISNIANMLNFKDNNINNEGMLRTVLDVGCGVASFGGYLLSSNVIAMSLAPN
DVHQNQIQFALERGIPAYLGVLGTKRLPYPSRSFELAHCSRCRIDWLQRDGILLLELDRL
LRPGGYFAYSSPEAYAQDEEDLRIWKEMSALVERMCWKIAEKRNQTVIWVKPLNNDCYKR
RAHGTTPPLCKSGDDPDSVWGVPMEACITPYPEQMHRDGGSGLAPWPARLTTPPPRLADL
YVTADTFEKDTEMWQQRVEKYWSLLGPKVKPDTIRNIMDMKANFGSFAAALKEKDVWVMN
VVPHDGPSTLKIIYDRGLIGSNHDWCEAFSTYPRTYDLLHAWAVFSDLDKRGCSAEDLLL
EMDRILRPTGFAIVRDKGTVIEFIKKYLHALHWEAVAAADAEPSSESEENEMILVIRKKL
WLPEAGSHT*

MKGRNDSGHSKRPVVLCCVMIVCLCLLFLYFSGSNGQAGSAAFEYGTKFSRSLGWGSDDG
EDGSEESIFGTGDADDVKPKSFPVCDDRHSELIPCLDRNLIYQMRLKLDLNLMEHYERHC
PPPERRFNCLIPPPHGYKVPIKWPKSRDVVWKANIPHTHLAKEKSDQNWMVEAGEKIKFP
GGGTHFHHGADKYISNIANMLNFKDNNINNDGMLRTVLDVGCGVASFGGYLLSSNVIAMS
LAPNDVHQNQIQFALERGIPAYLGVLGTKRLPYPSRSFELAHCSRCRIDWLQRDGILLLE
LDRLLRPGGYFAYSSPEAYAQDEEDLRIWKEMSALVERMCWKIAEKRNQTVIWVKPLDND
CYKRRAHGTKPPLCKSGNDPDSVWGVPMEACITPYPEQMHRDGGTGLAPWPARLTAPPPR
LADLYITADTFEKDTEMWQQRVENYWSLLGPKVKPDTIRNIMDMKANFGSFAAALKEKDV
WVMNVVPHDGPSTLKIIYDRGLIGSNHDWCEAFSTYPRTYDLLHAWAVFSDLDKRGCSAE
DLLLEMDRILRPTGFAIVRDKGTVIEFIKKYLHALHWEALTVVDAEPSPESEESEMILII
RKKLWLPKAGPQDSGT*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1830Length 2 (bp):1851Length divergence:0.006
MFE 1 (kcal):-573.76MFE 2 (kcal):-604.81MFE divergence0.026