Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107654-GRMZM2G117900
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100217157
Function (paralog2):hypothetical protein LOC100383287

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.4497209610629
Log2 mRNA fold difference:1.672980722254
Log2 TE fold difference:-0.19425174613253
Sequences
Protein sequence

MYPGLRRALAGDENPSVPKMARRGLMEQDLSKLDVTKLHPLSPEVISRQATINMGTIGHV
AHGKSTVVKAISGVQTVRFKNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKE
DSPLCDVPGFENTRMKLLRHVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPQ
TSEHLAAVEIMRLQHIIILQNKIDLIQESAAMNQHEAIQKFIQGTIAEGAPVVPISAQLK
YNIDVICEYLVKKIPIPERNFTSPPNMIVIRSFDVNKPGSEVDEIRGGVAGGSILRGVLR
VNQKIEVRPGIVMKDETGNIKCTPIYSRIVSLYAEQNELQFAVPGGLIGVGTTMDPTLTR
ADRLVGQVLGEVGSLPDVYVELEINFFLLRRLLGVRTKGTEKAGKVSKLTKGEILMLNIG
SMSTGARVLAVKNDLAKLQLTAPVCTSRGEKVALSRRVEKHWRLIGWGQIQAGTTLEVPA
CPV*

MARRGLMEQDLSKLDVTKLDPLSPEVISRQATINIGTIGHVAHGKSTVVKAISGVQTVRF
KNELERNITIKLGYANAKIYKCEDDRCPRPMCYKAYGSGKEDSPLCDVPGFENTRMKLLR
HVSFVDCPGHDILMATMLNGAAIMDGALLLIAANESCPQPQTSEHLAAVEIMRLQHIIIL
QNKIDLIQESAAMNQHEAIQKFIQGTIAEGAPVVPISAQLKYNIDVICEYIVKKIPIPER
NFTSPPNMIVIRSFDVNKPGSEVDEIRGGVAGGSILRGVLRVNQKIEVRPGIVMKDENGN
IKCTPIYSRIVSLYAEQNELQFAVPGGLIGVGTTMDPTLTRADRLVGQVLGEVGSLPDVY
VELEINFFLLRRLLGVRTKGTEKAGKVSKLTKGEILMLNIGSMSTGARVLAVKNDLAKLQ
LTAPVCTSRGEKVALSRRVEKHWRLIGWGQIQAGTTLEVPPCPL*

Other information
Ka divergence:-0.519006KaKs divergence:-0.545918
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1452Length 2 (bp):1395Length divergence:-0.02
MFE 1 (kcal):-483.89MFE 2 (kcal):-450.22MFE divergence-0.036