Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107745-GRMZM2G358416
Species:maize
Duplication type:WGD
Function (paralog1):pre-mRNA branch site p14-like protein
Function (paralog2):hypothetical protein LOC100382393

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.6497681111791
Log2 mRNA fold difference:1.5573561323017
Log2 TE fold difference:1.0955198124867
Sequences
Protein sequence

MAAAGLRKGNARLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIRQIRLGNAKDTRGTA
YVVYEDIYDAKNAVDHLSGFNVANRYLIVLYYQPAKMSKKSDVKKKEDEITRLQEKYGIG
SKTPGPGSTD*

MAAAGLRKGNARLPPEVNRVLYVRNLPFNISSEEMYDIFGKYGAIRQIRLGNAKDTRGTA
YVVYEDIYDAKNAVDHLSGFNVANRYLIVLYYQPAKMSKKSDIKKKEDEITRLQEKYGIG
SKTPGPGSSD*

Other information
Ka divergence:1KaKs divergence:0.98773
GC content 1 (%):61GC content 2 (%):62GC content divergence:0.008
Length 1 (bp):393Length 2 (bp):393Length divergence:0
MFE 1 (kcal):-145.1MFE 2 (kcal):-145.4MFE divergence0.001