Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107774-GRMZM2G113486
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277367
Function (paralog2):hypothetical protein LOC100278877

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.4047124384088
Log2 mRNA fold difference:0.083382699986641
Log2 TE fold difference:0.27556282634444
Sequences
Protein sequence

MGVRFSGVGKGGRGGRQGSAIPPQESRPIGIAEMNSSGEYDAAFAATIAAAAFAIAARED
KLAAQKNSVPIEEVTPSLSPVNRAEGTKKPAGGNKIARWFSGKEPIEHDDDDEGPVNVSV
RRPLKPAPGKPEDVPADHHKVAPRMLETSLGVRKGSGSSSRSAERKWSKEFEQEQAVQKA
PSAVRPATSYRSGRNGEGAAGVAATGGTGSKADEWEKAKLGRVREEYEKMMETIAEWETE
KKVKARRQKEQKETELDRKREKALEEYNLEMTRISKISGGARAMAEERKYNDRKKIREKA
RKMRSTGKPPRTCACF*

MQASRLLNTRLSLVTEAARRLVPRNLPTAIGSVSLQSTNTSRAMDGDSKKLRVWFSGVGK
GGGGGRQSSAAPPQESAPIGRAEMNSSGEFDAAFAATIAAAAFAIAAREEKLAAQKKSVP
IEEVPRALSLVKRAGSTKKPAGGNKISRWFSGKEPLEHDDDGPVSRPLKPAPGKPEGMPA
DHKVAPKILETSLSVRKGSGSSGKTTDRKGSKKFEQEHVQKAPSIIRPSTSYHSRRNGED
AAGVAAIGGTRSKADEWEKAKLAKVREEYEKMMETIAEWETEKKVKARRHKEQRETVLDR
KRAKALEEYNQEMTRISKIAGGARSMAEERKYNDENKIKEKAHKIRSTRKPPRTCACF*

Other information
Ka divergence:-0.136666KaKs divergence:0.595317
GC content 1 (%):54GC content 2 (%):51GC content divergence:-0.029
Length 1 (bp):951Length 2 (bp):1077Length divergence:0.062
MFE 1 (kcal):-306.6MFE 2 (kcal):-352.16MFE divergence0.069