Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G107854-GRMZM2G113506
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):hypothetical protein LOC100384251

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.22166482936565
Log2 mRNA fold difference:-0.1552361478312
Log2 TE fold difference:-0.069510660804082
Sequences
Protein sequence

MQLRISPSMRSITISSSNGVVDSMKVRVAPQPPPPPPPLHGAARRGGGGGGGWYWRAVAF
PLVVALGCLLPFAFILAAVPALEAGGSKCSSVDCLGRRIGPSFLGRQGGDSTRLVQDLYR
TFDQVNNEESPSDEKLPESFRDFLLEMKDNHYDARTFAVRLKATMENMDKEVKRSRLAEQ
LYKHYAATAIPKGIHCLSLRLTDEYSSNAHARKQLPPPELLPLLSDNSFQHYILASDNIL
AASVVVSSTVRSSSVPEKVVFHVITDKKTYPGMHSWFALNSVSPAIVEVKGVHQFDWLTR
ENVPVLEAIESHRGVRNHYHGDHGTVSSASDNPRMLASKLQARSPKYISLLNHLRIYLPE
LFPNLNKVVFLDDDIVVQRDLSPLWAINLEGKVNGAVETCRGEDSWVMSKRFRTYFNFSH
PVIARSLDPDECAWAYGMNIFDLAVWRKTNIRDTYHFWLKENLKSGLTLWKFGTLPPALI
AFRGHVHGIDPSWHLLGLGYQDKTDIESVRRAAVIHYNGQCKPWLDIAFKNLQPFWTNHV
NYSNDFVRNCHILEPERVKE*

MQLRISPSMRSITISSSNGVVDSMKVRVAPQPPPPPPPPHGAARRGGGGGGGWYWRAVAF
PLVVALGCLLPFAFILAAVPALEAGGSKCSSVDCLGRRIGPSFLGRQGGDSTRLVQDLYR
FFDQVNKEEFPSDEKLPESFRDFLLEMKDNHYDARTFAVRLKATMETMDKEVKRSRLAEQ
LYKHYAATAIPKGIHCLSLRLTDEYSSNAHARKQLPPPELLPLLSDNSLQHYILASDNIL
AASVVVSSIVRSSSLPEKVVFHVITDKKTYPGMHSWFALNSIAPAIVEVKGVHQFAWLTR
ENVPVLEAIENHRGVRNHYHGDHGTVSSASDNPRVLASKLQARSPKYISLLNHLRIYLPE
LFPNLNKVVFLDDDIVVQRDLSPLWAINLEGKVNGAVETCRGEDSWVMSKRFRTYFNFSH
PVIARSLDPDECAWAYGMNIFDLAAWRKTNIRDTYHFWLKENLKSGLTLWKFGTLPPSLI
AFRGHVHGIDPSWHLLGLGYQDKTDIESVRRAAVIHYNGQCKPWLDIAFKNLQPFWTKHV
NYSNDFVKNCHILEPQHVKE*

Other information
Ka divergence:0.326194KaKs divergence:-0.999795
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):1683Length 2 (bp):1683Length divergence:0
MFE 1 (kcal):-569.11MFE 2 (kcal):-564.65MFE divergence-0.004