Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G108008-GRMZM2G177654
Species:maize
Duplication type:WGD
Function (paralog1):30S ribosomal protein S17
Function (paralog2):LOC100283761

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.5401047244463
Log2 mRNA fold difference:-1.4208236252927
Log2 TE fold difference:0
Sequences
Protein sequence

MEPVVGIVVSNKMQKSVVVAVDRLFHYKMYNRYVKRTSKFMAHDEADSCNIGDRVRLDPS
RPLSRYKHWVVAEILRRAKVYVPPAATASSQSSEHNSKSQKAGVATK*

MKPVVGIVVSNKMQKSVVVAVDRLFHNKVYNRYVKRTSKFMAHDDDDSCNIGDRVRLDPS
RPLSRHKHWVVAEILRRAKVYVPPAATASSERGSKSQQAGGATK*

Other information
Ka divergence:0.0708194KaKs divergence:-0.0508197
GC content 1 (%):51GC content 2 (%):53GC content divergence:0.019
Length 1 (bp):324Length 2 (bp):315Length divergence:-0.014
MFE 1 (kcal):-100.2MFE 2 (kcal):-103.2MFE divergence0.015