Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G108115-GRMZM2G521844
Species:maize
Duplication type:WGD
Function (paralog1):endoplasmic oxidoreductin-1
Function (paralog2):hypothetical protein LOC100383981

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.5790323832823
Log2 mRNA fold difference:-1.4776127078713
Log2 TE fold difference:-0.1750717613059
Sequences
Protein sequence

MTMTPAPVANGAAAGAGGGMKRRGGRLWYAAAGALLVALLAVAVSYRSFPGVPSSPSSPG
SCGCPAARKYTGMVEDCCCDYETVDAINEEVLHPILQELVKLPFFRYFKVKLWCDCPFWP
DDGMCKLRDCSVCECPENEFPEPFRKPYNGLSPDSMMCQEGKPQAAVDKTLDSKVFKGWV
ETDNPWTSDDETDNNEMTYVNLQLNPERYTGYTGDSARRIWDAIYKENCPKYPSEELCHE
KKALYKLISGLHSSISVHIAYDYLLDESTNSWGQNLPLLYDRVLKYPERVQNLYFTYLFV
LRAVTKAANYLEQAEYNTGNPEDDLKTESLVKQLLYNSKLRSACPLPFDEAKLWQGENGP
ELKQEIQKQFRNISAIMDCVGCEKCRLWGKLQVHGLGTALKILFSVDGDSHMNQPLQLQR
NEVIALFNLLNRLSESVKFVHEKGSSIEEVIEEQIPSTVQKSVSMPNLKLDFL*

MNPAPVANGAAAGAGVGMNRLGGRLWYAAAGALIVALLAVAVSYRSFPDIPSSSPGSCGC
PAARKYTGMVEDCCCDYETVDAINEEVLHPILQELVKLPFFRYFKVKLWCDCPFWPDDGM
CKLRDCSVCECSENEFPEPFRKPYSGLSPDSMMCQEGKPQAAVDKTLDSKVFKRWVETDN
PWTSDDETDNNEMTYVNLQLNPERYTGYTGDSARRIWDAIYKENCPKYPSEELCHEKKVL
YKLISGLHSSISVHIAYDYLLDESTNSWGQNLSLLYDRVLKYPERVQNLYFTYLFVLRAV
TKAADYLEQAEYNTGNPEDDLKTESLVKQLLYNSQLRSACPLPFDEAKLWQGENGPELKQ
EIQKQFRNISAIMDCVGCEKCRLWGKLQVLGLGTALKILFSVDGDSHLNQPLQLQRNEVI
ALFNLLNRLSESVKFVHEKGSSVEEVINEQSPSTVQKGASKTNLKGLFGYSQYTWIGWD*

Other information
Ka divergence:0.260747KaKs divergence:-0.0713359
GC content 1 (%):48GC content 2 (%):47GC content divergence:-0.011
Length 1 (bp):1422Length 2 (bp):1440Length divergence:0.006
MFE 1 (kcal):-468.48MFE 2 (kcal):-476.01MFE divergence0.008