Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G108118-GRMZM2G155077
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hsp20/alpha crystallin family protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:1.8835616169687
Log2 mRNA fold difference:2.2875203553648
Log2 TE fold difference:-0.40428872284872
Sequences
Protein sequence

MTTVNVNPVYEWLDDGASHLLRLDLPVPGFKGEDFNVYVDGEARRIIVFGSDGKALWLHN
TFQLPDTANHDTITYSFDSNVLTLTMPKLPAAPAPPPPPQAKEEARVAGGKKPADQEGKL
GAKVGGGHGGAATEERTTAEAEERTTSLTASSKEEDEKARPTAPPPPPPQSNEKAQDHQD
GKARAGHREMVAREAARRIEAARARVAEAKAKAELERKWEHWKERAVEEGVKLAEALNKN
KEVIATAVAAFALGVLVSNRIFCRN*

MASTQAPAAADNVDPVYEWLDDGASYLLRLDLPGFKKEDFRVHVDGEGRLTVIGNRKPTP
GGGGKALRLHKTFQLPNTANLDTITGRFDGNVLTLTVPKLLAGADAPTTPPPQSKEEARV
AGDKPDQADKLPARVGRGREETTEERRTTETERTSLAATSKEEDEEKAKPMVALPPQSSE
KASGDHQRDDQQDGKAQADHRHREMVAREAARRIEAARARVAEAKAKAERERKCEHWKER
AVEEGLRLAEAVNNKKEVIATAVAAFTLGVFVSSRLFSRT*

Other information
Ka divergence:-0.498217KaKs divergence:-0.580753
GC content 1 (%):66GC content 2 (%):66GC content divergence:0
Length 1 (bp):798Length 2 (bp):843Length divergence:0.027
MFE 1 (kcal):-358.44MFE 2 (kcal):-385.3MFE divergence0.036