Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G108144-GRMZM2G155021
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273703
Function (paralog2):Outer plastidial membrane protein porin (Voltage-dependent anion-selective channel protein)(VDAC)

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.5361486377355
Log2 mRNA fold difference:3.7493249200969
Log2 TE fold difference:-1.2270257635644
Sequences
Protein sequence

MAPGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPHGIAITAAGTRKNESTFGDLHTQIKN
NKLTVDVKANSESDLLTTITVDEIGTPGLKSILTLVVPDQRSGKLELQYLHEYTGVNASI
GLNSNPMVNLSGAFGSKALSVGVDVSFDTETSNFTKYNAALSLANPDLIASLHLNNHGDT
LVASYYHLVKHHSGTAVGAELSHSISRNESTLIFGSQHSLDPHTTVKARFNNYGMASALV
QHEWRPKSFITVSGEVDTRAIEKSTKVGLSLVLKH*

MAPGLYTDIGKKTRDLLYKDYNTHQKFSLTTCSPNGVAITAAGTRKNESIFGELHTQIKN
KKLTVDVKANSESDLLTTITVDEFGTPGLKSIINLVVPDQRSGKLEFQYLHEYAGVNASV
GLNSNPMVNLSGAFGSKALSVGVDVSFDTATSDFTKYNAALSLTSPDLIASLHLNNHGDT
LVASYYHLVKNHSGTAVGAELSHSMSRNESTLIFGSQHSLDPHTTIKTRFNNYGMASALV
QHEWRPKSFVTISGDVDTKAIEKSTKVGLSLVLKH*

Other information
Ka divergence:-0.0180318KaKs divergence:0.0889647
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):828Length 2 (bp):828Length divergence:0
MFE 1 (kcal):-245.28MFE 2 (kcal):-249.4MFE divergence0.008