Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G108318-GRMZM2G023667
Species:maize
Duplication type:WGD
Function (paralog1):glycylpeptide N-tetradecanoyltransferase 1
Function (paralog2):single myb histone3

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAAPNSNDAASASGTGPAGEEDISIEALARRVQEHMTLSSNPAARRHKFWETQPVGQFRD
VADTSLPDGPIEPPTPLSEVRADPYPLPAAFEWLTCDLDDDALLADLYSLLAHNYVEDDE
NMFRFNYSPAFLRWALKPPSFFRAWHIGVRAKESKKLVAFISGVPARIRARDDVVRMAEI
NFLCVHKKLRSKRLAPVLIREVTRRVHQENIWQAAYTAGVVLPTPITTCRYWHRSLNPKK
LIDVGFSRLGPRMTMSRTVRLYKLPDAPLTPGFRRMELRDVAAVTRLLRAYLARFVVAPD
FDEVDVEHWLLPQEDVVDSYLVESPETHEVTDFCSFYTLPSSVLNNANYATLKAAYSYYN
VSTKTALQQLMNDALIVAKQKNYDVFNALDVMENESFLKELKFGPGDGQLHYYLYNYRIR
NGIKPSELGLVLL*

MAAPNSNDAASASGTGPAGEEDISIEALARRVQEHMTLNSNPAARRHKFWETQPVGQFRD
AADASLPNGPIEPPTPLSEVRADPYPLPAAFEWLTCDLDDDALLADLYSLLAHNYVEDDE
NMFRFNYSPAFLRWALKPPSFFRAWHIGVRAKESKKLVAFISGVPARIRARDDVVRMAEI
NFLCVHKKLRSKRLAPVLIREVTRRVHQENIWQAAYTAGIVLPTPITTCRYWHRSLNPKK
LIDVGFSRLGPRMTMSRTVRLYKLPDAPLTPGFRRMELRDVAAVTRLLRAYLARFVVAPD
FDEVDVEHWLLPQEDVVDSYLVESPETHEVTDFCSFYTLPSSVLNNANYATLKAAYSYYN
VSTKTPLQQLMNDALIVAKRNNYDVFNALDVMENESFLKELKFGPGDGQLHYYLYNYRIR
NGIKPSELGLVLL*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):61GC content 2 (%):60GC content divergence:-0.008
Length 1 (bp):1302Length 2 (bp):1302Length divergence:0
MFE 1 (kcal):-497.01MFE 2 (kcal):-488.92MFE divergence-0.008