Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G109056-GRMZM2G102760
Species:maize
Duplication type:WGD
Function (paralog1):lipoxygenase
Function (paralog2):lipoxygenase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MFWHGVADRLTGKNKEAWNEGKIRGTVRLVKKEVLDVGDFNASLLDGVHRILGWDDGVAF
QLVSATAADPSNGSRGKVGKAAHLEEAVVSLKSTTDGETVYRVSFEWDGSQGVPGAVLVR
NLQHAEFFLKSLTLEGVPGRGTVVFVANSWIYPHNLYSQERVFFANDTYLPSKMPAALVP
YRQDELKILRGDDNPGPYKEHDRVYRYDYYNDLGEPDKGEDHARPVLGGSQEHPYPRRCR
TGRRPTETDPNSESRLFLLNLNIYVPRDERFGHLKMSDFLGYSLKAIIEAVLPTLGTFVD
DTPKEFDSFEDILGLYEPGPEAPNNPLVAEVRKRIPSEFLRSILPNGSHDHPLKMPLPNI
IRSDVLKKAPEFKFGWRTDEEFARETLAGVNPVLIKRLTEFPAKSTLDPSQYGDHTSKIT
EAHIQHNMEGLSVQNALKKNRLFILDHHDHFMPYLNKINELEGNFIYASRTLLFLKDDGT
LKPLAVELSLPHPDGQQHGAVSKVYTPAHSGAEGHVWQLAKAYACVNDSAWHQLISHWLN
THAVIEPFVIATNRQLSVVHPVHKLLSPHYRDTLNINALARQTLINADGIFERTVFPAKY
ALGMSSDVYKSWNFNEQALPADLVKRGVAVPDQSSPYGVRLLIKDYPYAVDGLVIWWAIE
RWVKEYLDVYYPNDGELQRDVELQAWWKEVREEAHGDLKDRDWWPRMDAVQRLARACTTV
IWVASALHAAVNFGQYPYAGYLPNRPTVSRRPMPEPGSDDYKKLEAGQKEADAVFIRTIT
SQFQTILGISLIEILSKHSSDEVYLGQRDEPERWTSDARALDAFRRFGSRLVEIEKRIRT
MNDSPTLKNRKGPVEMPYMLLYPNTSDVTGEKGEGLTAMGIPNSISI*

MFWHGVADRLTGKNKEAWSEGKIRGTVRLVKKEVLDVGDFNASLLDGVHRILGWDDGVAF
QLVSATAADPSNGGRGKVGKAAHLEEAVVSLKSTADGETVYRVSFEWDESQGIPGAVLVR
NLQHAEFFLKTLTLEGVPGKGTVVFVANSWVYPHKLYSQERIFFANDTYLPSKMPAALVP
YRQDELKILRGDDNPGPYQEHDRVYRYDYYNDLGDPDKGEEHARPILGGSQEHPYPRRCR
TGRHPTKKDPNSESRLFLLNLNIYVPRDERFGHLKMSDFLGYSLKTIIEAVLPTLGTFVD
DTPKEFDSFEDILGLYELGPEAPNNPLIAEIRKKIPSEFLRSILPNGSHDHPLKMPLPNV
IKSDVLKKAPEFKFGWRTDEEFARETLAGVNPVIIKRLTEFPAKSTLDPRQYGDHTSKIT
EAHIRHNMGGLSVQNALRNKRLFILDHHDHFMPYLDEINELEGNFIYASRTLLFLKDDGT
LKPLAIELSLPHPDGQQRGAVSKVYTPAHTGVEGHVWQLAKAYACVNDSAWHQLISHWLN
THAVIEPFVIATNRQLSVVHPVHKLLSPHYRDTLNINALARQTLINAGGVFERTVFPAKY
ALGMSADVYKSWNFNEQALPADLVKRGVAVPDQSSPYGVRLLIKDYPYAVDGLVIWWAIE
RWVKEYLDIYYPNDGELQRDVELQAWWKEVREEAHGDLKDRDWWPRMDTVQQLARACTTI
IWVASALHAAVNFGQYPYAGYLPNRPTASRRPMPEPGSHDYKKLGAGQKEADMVFIRTIT
SQFQTILGISLIEILSKHSSDEVYLGQRDEPDRWTSDAKALDAFKRFGSRLVQIENRIKT
MNDSPDLKNRKGPVEMPYMLLYPNTSDVTGEKAEGLTAMGIPNSISI*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):60GC content divergence:-0.016
Length 1 (bp):2664Length 2 (bp):2664Length divergence:0
MFE 1 (kcal):-1149.2MFE 2 (kcal):-1113.57MFE divergence-0.016